KEGG   Picrophilus torridus: PTO0784
Entry
PTO0784           CDS       T00177                                 

Name
(GenBank) transporter
Organism
pto  Picrophilus torridus
SSDB
Motif
Pfam: AA_permease_2 AA_permease
Other DBs
NCBI-ProteinID: AAT43369
UniProt: Q6L0Y3
Position
797689..799017
AA seq 442 aa
MDLFFFNDFTKYIIFLLNRLYMIRLSQSVMQSFTSIGPMLDFVALFSIIASYSGTMLPFV
VLFSFILSYSTLYTVYQFSRRFTTNGGYYSYVGNTMGKSLGLFVMLFYIMYSILTVPNLS
IFVSSFIYNILIIFGIDYKAIEYVILIIFIILVYSVIASGSRISIKYTLIAGLMEMSFII
IMSILFLGYRHYPIEYKYSFNAFFLGVIFGILAFSGGGSSIFLSENTRSSKRTTPRALLI
SYTLSGSIMVFSAFALLFFVGVNGIYSYSIDPYYIVSYISDRFGIYFMMVFAFFAILSAF
NLSVSYLNAFVHMMPRMLNDLKIKNRGNYIILLFLISIVISFLSISLLGFFNAFVFIAGL
ISFLYIVVHIITNISLIRINRSFVPVLSGIFLIISMILSFSGNMALIPSINYAFIIYLII
SIIIVLIIRSSDYYKSINFYIN
NT seq 1329 nt   +upstreamnt  +downstreamnt
atggatttattctttttcaatgattttacaaaatatattatatttttattaaataggctt
tacatgatcaggctctcccagtctgtaatgcagtcattcacatcaataggcccgatgctg
gacttcgttgcattattctcaattattgcatcatactctggaaccatgcttccatttgtt
gttttattctcatttatactttcatactcaacattatacactgtttatcaattttcaagg
agatttacaacaaatggtggctattactcatatgttggaaacaccatgggcaaatcgctt
gggctttttgtgatgcttttttatattatgtattcaatattaactgtgccaaacctatca
atctttgtttcatcctttatttataatatattaataatttttggaatagattataaggcc
attgaatatgtaatattgataatttttataatacttgtttattctgttatagcctcaggt
tcaaggatatcaataaaatacacattaattgccggattaatggagatgtcctttataata
ataatgagcattctattccttggttacaggcattatccaattgaatataaatacagcttc
aatgcattcttccttggtgtaatatttggaatactggcattctctggtggcggctcaagc
atctttctatccgagaacacaaggagctcaaagaggactacaccaagggcgctcctgata
tcatatacattatcaggctcaataatggtgttctcggcatttgcacttttattcttcgtt
ggtgtaaatggcatttattcatattcaatagatccttactatattgtttcatacatttca
gacagattcgggatatatttcatgatggtctttgcattctttgcaattctaagcgccttc
aatctcagtgtttcatatttaaatgcctttgttcacatgatgccaaggatgctaaacgat
cttaaaataaaaaatcgtggtaattatatcatcttactgtttttaatttcaattgtcata
tcctttttatcaataagcctccttggattttttaatgcctttgtctttattgcaggtcta
ataagctttctatacatcgttgttcatattataacaaacatatcattgatcaggataaat
agatcctttgtacctgtgctttcaggaattttccttataataagcatgatactgtcattt
tctggaaacatggccttaataccatcgataaactatgcatttattatttatctaataata
tcaataataattgttttaataataaggtcctcggattattacaaatcaataaatttttac
atcaattaa

DBGET integrated database retrieval system