KEGG   Picrophilus torridus: PTO0873Help
Entry
PTO0873           CDS       T00177                                 

Definition
(GenBank) replication factor C, large subunit
  KO
K04800  replication factor C large subunit
Organism
pto  Picrophilus torridus
Pathway
pto03030  DNA replication
Brite
KEGG Orthology (KO) [BR:pto00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    PTO0873
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pto03032]
    PTO0873
DNA replication proteins [BR:pto03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    RFC (replication factor C)
     PTO0873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA AAA_22 Rad17 RuvB_N AAA_5 DUF2075 AAA_30 AAA_24 AAA_14 AAA_16 TIP49 AAA_18 AAA_11 AAA_19 AAA_6 RNA_helicase AAA_25 AAA_2 TEX12 TsaE Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: AAT43458
UniProt: Q6L0P4
Position
complement(888894..890126)
Genome map
AA seq 410 aa AA seqDB search
MAWADKYRPVDISELIMPSDELNSIIRWADSWRNNEVIKKSLILYGDPGTGKTTTATVIA
NYLNVPLIEMNASDERNADSMKRVALMSSLYSDLLSERRIPDRLILIDEADNIFESRDPK
RGGDYGGITELLNVVKETRNPVIITMNDYYSFRSKRSGREIIDNSLVIEMRPYRRRNDQR
YREFINKCLERCHYILKKEGKSLPENDIIRIIKENEPDIRSIINDLEAYAQDSNPGTRNK
KIDIYRYVIDTFHSHDYDKLINSFSDADFDPDYYIKWIDQNLKEEYQDPEDLKNAYDILS
IADLYSRLSYRANYMLTGISQEIAAGVSLMVKNKNRSTGRYSMPDIIKMYSSRKGINGAR
TLLEKLAALNHTSSNVIVSYLWFYRIIKRTAEFKRISRILDLSDNEVKQI
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcatgggctgacaagtacaggccggtggatatttccgagcttataatgccatctgat
gaattaaacagcataataagatgggccgattcatggaggaacaatgaggtaataaaaaag
tcgcttatactttacggcgatccgggaaccggtaaaacaacaacggcaacggtgatagca
aattaccttaatgtgccattaatagagatgaacgcctctgatgaaagaaatgcggatagc
atgaagcgcgttgctttaatgtcatcgctgtattcagatctattatccgagagaagaata
ccagacagattaatattaatagatgaggctgataacatctttgaatccagggatccaaaa
aggggcggtgactatggaggcattacagaactattaaatgttgtaaaggaaacaaggaat
cctgttataataaccatgaacgactactattcatttagatcgaaaaggagcggcagggag
atcattgacaattcactggttatagagatgaggccatacaggagaagaaacgatcagagg
taccgtgaatttataaacaaatgccttgaaagatgccattacatattaaaaaaggaggga
aaatccctgcctgaaaacgatataataagaataataaaggagaacgagcctgacataaga
tcgataataaatgatcttgaggcctatgcacaggattcaaatccgggaacaagaaataaa
aagatcgatatatacaggtatgtaattgatacatttcacagccatgattatgataaatta
ataaactcattcagcgatgcagactttgatcctgattattatataaaatggatagaccag
aacctaaaggaggagtatcaggatcctgaagatctaaaaaatgcatatgatatcctatca
attgcggatctttatagcaggctttcatacagggcaaactacatgcttacaggcatttcg
caggaaatagctgctggtgtctcattaatggttaaaaacaaaaacagaagcaccggcagg
tactcgatgccggatataataaagatgtactcatccagaaagggaataaacggcgcaaga
acacttttggaaaagcttgcagcattgaaccatacatcatcaaatgtgattgtatcatat
ctatggttttacaggattattaaaagaacggctgaattcaaaaggatatcaaggatactg
gatctaagcgataacgaggttaagcaaatttag

DBGET integrated database retrieval system