KEGG   Picrophilus torridus: PTO0907
Entry
PTO0907           CDS       T00177                                 
Name
(GenBank) gluconolactonase
Organism
pto  Picrophilus torridus
SSDB
Motif
Pfam: SGL Arylesterase Str_synth
Other DBs
NCBI-ProteinID: AAT43492
UniProt: Q6L0L0
Position
complement(924479..925300)
AA seq 273 aa
MELNIEPQRLGESPIYIRELDTFLWVDILNGDIFSYNGNAKMEMHVNDMITSISPYKGTE
VIASLRDGIAIIDWKNKITNTLLKLDFPENIRFNDGRCDARGRFFIGTMDMNEKEPLGAL
YKFSGRKLERVLDNVTISNGIAWSLDSRFMYYIDSPRKSVQVFDYDLSMGRITRHLYDID
LKNYSGVPDGMAIDINNNLWVAIHGSSLISVIDPAKNEILNEVKIAAKKVTSCTFGSVNM
DKLFVTSAYDGTGGIPFIIDTGSRGVELNRYIP
NT seq 822 nt   +upstreamnt  +downstreamnt
atggagttaaatattgagccgcagaggcttggcgagtcaccgatatacataagggaactt
gatacctttctatgggtggatatactcaatggagatatattttcatacaacggtaatgca
aaaatggagatgcatgtaaacgatatgataacatcgatatcaccatataagggtacggag
gtaatagcatcccttagggacgggatagcaataatagactggaaaaataaaataacaaat
acgcttttaaagcttgatttccctgagaatattagattcaatgacggtagatgcgatgcc
agaggtagatttttcataggaaccatggacatgaacgaaaaggagcctttgggggcgctt
tataaattctccggcagaaagcttgaaagggttcttgacaatgtaacaatatccaatggc
attgcatggtcccttgattcaagatttatgtattatattgatagcccgagaaagagcgta
caggtctttgattatgatctatccatggggaggattacaaggcatctttatgacattgat
ctgaaaaattattctggtgttccagacggtatggccattgatattaataataatctctgg
gttgccattcatggcagctcattaatatcagttatagatccggctaaaaatgaaatatta
aacgaggtaaaaatagctgctaaaaaggtaacatcatgcacatttggctcggttaacatg
gataagctctttgtaacatctgcctacgatggaactggcggtattccttttataattgat
accggttccagaggcgttgaattaaatagatacattccatga

DBGET integrated database retrieval system