KEGG   Picrophilus torridus: PTO0998Help
Entry
PTO0998           CDS       T00177                                 

Definition
(GenBank) succinate dehydrogenase, subunit D
  KO
K18859  succinate dehydrogenase / fumarate reductase, subunit D
Organism
pto  Picrophilus torridus
Pathway
pto00020  Citrate cycle (TCA cycle)
pto00190  Oxidative phosphorylation
pto00650  Butanoate metabolism
pto00720  Carbon fixation pathways in prokaryotes
pto01100  Metabolic pathways
pto01110  Biosynthesis of secondary metabolites
pto01120  Microbial metabolism in diverse environments
pto01200  Carbon metabolism
Module
pto_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pto_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PTO0998
   00650 Butanoate metabolism
    PTO0998
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PTO0998
   00720 Carbon fixation pathways in prokaryotes
    PTO0998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAT43583
UniProt: Q6L0B9
Position
1007369..1007698
Genome map
AA seq 109 aa AA seqDB search
MKIDGAELGEEKPVSERPGGKPFAREIDYRVGDLFWGKIHIRNSGKMYMLVTSKIPFNWK
PLVKDLKLKGKVVDSAGGFLWVQEDEKYINDDVKFLKDYLEKMKNSKKE
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagatggagccgagcttggcgaggagaagcccgtatctgaaagaccgggcggg
aagccatttgcaagggaaatcgattaccgcgttggggacctcttctggggaaagatacat
ataagaaacagcggtaagatgtacatgctcgtcacatccaagataccatttaactggaag
ccgctggtcaaggatttaaaattaaagggaaaggttgttgattccgcaggtggctttctc
tgggttcaggaagatgaaaaatatataaatgacgatgtaaaatttttaaaggattattta
gaaaagatgaaaaatagtaaaaaggaataa

DBGET integrated database retrieval system