KEGG   Picrophilus torridus: PTO1002Help
Entry
PTO1002           CDS       T00177                                 

Definition
(GenBank) succinyl-CoA synthetase alpha chain
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
pto  Picrophilus torridus
Pathway
pto00020  Citrate cycle (TCA cycle)
pto00640  Propanoate metabolism
pto00660  C5-Branched dibasic acid metabolism
pto00720  Carbon fixation pathways in prokaryotes
pto01100  Metabolic pathways
pto01110  Biosynthesis of secondary metabolites
pto01120  Microbial metabolism in diverse environments
pto01130  Biosynthesis of antibiotics
pto01200  Carbon metabolism
Module
pto_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pto_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PTO1002
   00640 Propanoate metabolism
    PTO1002
   00660 C5-Branched dibasic acid metabolism
    PTO1002
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PTO1002
Enzymes [BR:pto01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PTO1002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig IlvN GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AAT43587
UniProt: Q6L0B5
Position
complement(1011028..1011882)
Genome map
AA seq 284 aa AA seqDB search
MVLINRNTRVIIQGITGHQGSFHSGEMLKFGTNIVAGVSPGKGGSKINNIPVYDTIDEVM
DLKPDATMISVPAPFVKDAALEAIDHGIKFIYILTEHVPVQDTMEIVNQAKRKNIFMIGP
NGPGITVVGESKIGIMPNNIFRKGRVAVASRSGTLTYEIVNAITQAGLGESTVIGLGGDP
IVGTTFTEVVRIFNEDPETDMIVMVGEIGGSEEERAASYVKEHVKKKVVGYITGRSAPPG
KRMGHAGAIIEKGAGTAESKIRAFESAGIKVAEYPYQIPDLLKQ
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggtattaataaacaggaatacaagggtaattatacagggaataacaggccaccaggga
tctttccattccggcgagatgctaaaatttggaacaaacatcgttgcaggggtttcacca
ggaaagggtggctcaaaaattaataatatcccggtctatgatacaattgatgaggtaatg
gatctaaagcctgatgcaacaatgatatctgttccggcaccgtttgttaaggatgcagca
cttgaggcaatagatcatggaataaaatttatatatatattaacggaacatgtgccagtc
caggatacaatggagattgtaaaccaggccaaaaggaagaacatattcatgataggccca
aacggtcctggaataacagtcgttggtgaatcaaagataggcataatgccaaacaatata
ttcagaaagggcagggttgctgttgcatcgagaagcggaacattaacctatgagattgta
aatgcaataacacaggccggccttggtgagagcaccgtcataggtcttggcggcgatcca
atagttggcacaacatttacagaggtcgtaaggatatttaatgaggatcctgagacagat
atgatcgtcatggttggcgagatcggtggcagcgaggaggagcgcgcggcatcttatgta
aaggagcatgtaaaaaagaaggttgttggatacataaccggaaggagtgcaccaccagga
aaaagaatgggccatgctggcgcaattatagagaagggtgcaggtacagcagagtcaaag
ataagggcatttgagtccgcgggtataaaggtcgcagagtatccataccagataccggat
ctattaaaacaatga

DBGET integrated database retrieval system