KEGG   Picrophilus torridus: PTO1008Help
Entry
PTO1008           CDS       T00177                                 

Definition
(GenBank) hypothetical prefoldin beta subunit
  KO
K04798  prefoldin beta subunit
Organism
pto  Picrophilus torridus
Brite
KEGG Orthology (KO) [BR:pto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pto03110]
    PTO1008
Chaperones and folding catalysts [BR:pto03110]
 Heat shock proteins
  GimC
   PTO1008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prefoldin_2 KASH_CCD DUF3585 COG5 CREPT Sin3_corepress ATG16 Leu_zip BLOC1_2 Prefoldin E2F_CC-MB NPR1_like_C FH2 ADIP Spt5_N Laminin_I
Motif
Other DBs
NCBI-ProteinID: AAT43593
UniProt: Q6L0A9
Position
1016386..1016757
Genome map
AA seq 123 aa AA seqDB search
MVEPNLSAYIQNQIKQAQDIEAQIESIASQRYQLDVLIRELDKTIKELKSISEGTPVYKS
VGPVMYLVEDKNKLINDLEEQKELSQMRSKTLENQQKSLEQKYREVQESLQKKYQEASKG
EGN
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
ttggtagagccaaatttaagtgcatatatacagaaccagataaagcaggcacaggacata
gaggcacagatagagagcatagcctctcagaggtaccagctcgatgtccttataagggag
cttgacaagaccataaaggaattaaagtcaatttctgaaggaacacctgtttataaaagt
gttggacccgttatgtaccttgttgaggataaaaataaacttataaatgatcttgaggaa
cagaaggaacttagccagatgaggagcaagaccctagaaaaccagcaaaaatcacttgaa
caaaagtaccgcgaggtgcaggaatcattacaaaaaaagtatcaggaagccagcaagggt
gaaggtaattga

DBGET integrated database retrieval system