KEGG   Picrophilus torridus: PTO1011Help
Entry
PTO1011           CDS       T00177                                 

Definition
(GenBank) hypothetical protein
  KO
K09129  uncharacterized protein
Organism
pto  Picrophilus torridus
Brite
KEGG Orthology (KO) [BR:pto00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    PTO1011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenosine_kin
Motif
Other DBs
NCBI-ProteinID: AAT43596
UniProt: Q6L0A6
Position
1018066..1018545
Genome map
AA seq 159 aa AA seqDB search
MIREIVIERPDDSNVILGYSHFIKTIEDLKEIVVTSVPKCRFGIAFSEASGERLIRFDGN
DRELTDIAVKNLLNVKSGHTFIIIIRDAYPINMLNAIKMCQEVGTIFAATANPLSVIVYE
GSNGNGILGVIDGYSPLGIEDEAAKEKRKKLLRDIGYKS
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgataagggaaatagtaattgaaagaccagatgattcaaacgtaattcttggttattca
cattttataaagaccatagaggatttaaaggagattgttgttacaagtgtaccaaaatgc
aggtttggcatagcattttctgaggcctccggtgaaaggctcattagatttgatggcaat
gacagggaactaactgatattgcagtaaaaaatcttttaaatgtaaagagcgggcataca
tttataataatcataagggatgcataccctataaacatgctcaatgccatcaagatgtgt
caggaggttggaacaatatttgcagcaactgcaaatcctttaagcgttattgtatacgaa
ggcagcaatggcaatggaatccttggcgttatcgatgggtactcaccacttgggatagag
gatgaggctgcaaaggaaaaaaggaaaaagcttttaagagatattggctacaagtcatag

DBGET integrated database retrieval system