KEGG   Picrophilus torridus: PTO1012Help
Entry
PTO1012           CDS       T00177                                 

Definition
(GenBank) lactate 2-monooxygenase
  KO
K00467  lactate 2-monooxygenase [EC:1.13.12.4]
Organism
pto  Picrophilus torridus
Pathway
pto00620  Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:pto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PTO1012
Enzymes [BR:pto01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.12  With incorporation of one atom of oxygen (internal monooxygenases or internal mixed-function oxidases)
    1.13.12.4  lactate 2-monooxygenase
     PTO1012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_dh IMPDH His_biosynth ThiG Glu_synthase
Motif
Other DBs
NCBI-ProteinID: AAT43597
UniProt: Q6L0A5
Position
complement(1018636..1019790)
Genome map
AA seq 384 aa AA seqDB search
MTNYGLNYQLRTYLKIDGNDMPVSINDWHDLAMKKLDNGPWGYLEGSAGSNDTEKNNERS
FLKYRIRPRYLRDVSNIDMSIRLFGKRFETPFILGPIGVTSIIHNDGDIAIAKAAENLGM
PFALSTVSSYSIEDVAKAAPNAERWFQLYPGRDKNIMKSMIRRAEKSGYSAIIVTVDTTM
LGWRETDLKNAYLPFLLGYGIANYITDPEFNARLDKSPEEDMNAAIEEFLSIYVNPGFTW
DDFSEIRSWTRLPLIIKGITHIDDVKKAFDYNADAVVISNHGGRQVDGAISSIDALHELS
LNDINGTILFDSGIRHAADAFKAIALGASAVLIGRPYIYALAVAGQAGIERYMDQLRSEF
NLEMALSGYGSLSELNRETIYVQK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgacaaattatggtttgaattaccagctgagaacatatttaaaaattgatggcaacgac
atgcccgtatcaattaatgactggcatgacctggcaatgaaaaagcttgataatggccca
tggggatatcttgagggttccgccggttccaatgataccgaaaaaaataatgaaagatct
tttttaaagtatagaataaggccaaggtatcttagagatgtctcgaatatagatatgtca
ataaggctttttggaaaaagatttgagacgccttttatacttgggccgataggcgtaacg
tcaattattcataatgatggcgatattgcaatagcaaaggcagcagaaaatcttggaatg
ccctttgcattaagtactgtgtcatcatacagcatagaggatgttgcaaaagcagcgcca
aatgcggaaaggtggtttcagctctacccgggcagggataaaaatattatgaaaagcatg
attagaagggcggaaaaatcaggctacagtgcaattatagtgactgttgatacaaccatg
cttggctggcgtgaaacagatctaaaaaatgcctacctgccgttcttgcttggttatgga
attgcaaattatataacagatcctgagttcaatgcaagactcgataaaagtccggaggag
gatatgaatgcagcaatagaggagtttctttccatttacgtgaatccaggatttacctgg
gatgacttttcagagataaggtcatggacgaggcttccattaattataaagggtataaca
catattgatgatgtgaaaaaggcctttgattataatgctgatgccgtggttatatcgaat
catggaggcagacaggttgatggtgcaatttcatcaatagatgcacttcatgaactttct
ttaaatgatataaatggcacaatattatttgatagcggcataaggcatgcggctgatgcc
ttcaaggccattgcccttggtgcatccgcagttcttataggcaggccatacatatacgca
ctggccgttgcaggccaggctggaattgaaagatacatggatcagttaagatcagaattt
aatttggaaatggccctttccggatatggatctttaagtgaattaaacagggaaacaata
tatgttcaaaaatga

DBGET integrated database retrieval system