KEGG   Picrophilus torridus: PTO1023Help
Entry
PTO1023           CDS       T00177                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pto  Picrophilus torridus
Pathway
pto00071  Fatty acid degradation
pto00072  Synthesis and degradation of ketone bodies
pto00280  Valine, leucine and isoleucine degradation
pto00310  Lysine degradation
pto00362  Benzoate degradation
pto00380  Tryptophan metabolism
pto00620  Pyruvate metabolism
pto00630  Glyoxylate and dicarboxylate metabolism
pto00640  Propanoate metabolism
pto00650  Butanoate metabolism
pto00720  Carbon fixation pathways in prokaryotes
pto00900  Terpenoid backbone biosynthesis
pto01100  Metabolic pathways
pto01110  Biosynthesis of secondary metabolites
pto01120  Microbial metabolism in diverse environments
pto01130  Biosynthesis of antibiotics
pto01200  Carbon metabolism
pto01212  Fatty acid metabolism
pto02020  Two-component system
Module
pto_M00849  C5 isoprenoid biosynthesis, mevalonate pathway, archaea
Brite
KEGG Orthology (KO) [BR:pto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PTO1023
   00630 Glyoxylate and dicarboxylate metabolism
    PTO1023
   00640 Propanoate metabolism
    PTO1023
   00650 Butanoate metabolism
    PTO1023
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PTO1023
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PTO1023
   00072 Synthesis and degradation of ketone bodies
    PTO1023
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PTO1023
   00310 Lysine degradation
    PTO1023
   00380 Tryptophan metabolism
    PTO1023
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PTO1023
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PTO1023
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PTO1023
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pto04147]
    PTO1023
Enzymes [BR:pto01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PTO1023
Exosome [BR:pto04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PTO1023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: AAT43608
UniProt: Q6L094
Position
1030882..1032069
Genome map
AA seq 395 aa AA seqDB search
MEDAYIVYFKRVPFSRARPNDPERDMYNDLRMDDLLSRLIRKSVDDTGINPEEIGDVITG
CAFQAGENWTYGGRHPVLLSELPVSVPAMSLDRACSSSLNAVSIGAMEIMSEKSDIVIAG
GMEHMTHVPLGISNPYIKPNMSLMLNPRYSKYDMNVSYNMGLTAEKLAALRGITRKEMDE
YSYNSHLRARKAYESGFMKDEIMPVTVERDGEEIKIEKDLSIRDDASLESMEALKPAFKP
DGIITAGNSAPLNDGASMVMLMSERAMNEYGLKPMARIVDFAAAGVDPTIMGDGPVPATR
KILSRNKIDPQDIDLWEINEAFAVVVLNAVKSFNLDLKKVNINGGGISIGHPLGATGARI
AGTLARQLANKRKRYGIATLCVGGGQGYSLLMERI
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggaggatgcatatatagtttatttcaaaagggtaccattctcaagggcaaggccaaat
gaccctgaaagggatatgtacaacgatttaaggatggacgatcttttatcaaggctgata
agaaaatctgttgatgatacaggaataaatccagaggagatcggagacgttataacaggc
tgtgcattccaggcaggtgagaactggacatacggcggcaggcatccggttcttttatcg
gaattgcctgtaagtgtgcctgcaatgtcgctggacagggcatgctcatcctcattaaac
gcggtttcaattggcgcaatggagatcatgtcagaaaaatctgatatagtaatagcaggt
ggcatggagcacatgacccatgtgccgcttggcatatcaaatccttatataaaaccgaat
atgtccttaatgctgaatccaagatattcaaaatatgacatgaacgtttcatataacatg
ggattaacagcagaaaagcttgctgcactaaggggaataaccagaaaggaaatggatgaa
tattcatacaattcacatttaagggcaagaaaggcatatgaatctggctttatgaaggat
gagataatgccagttacagtggaaagggatggcgaggaaataaaaatagaaaaggatctt
agcataagggacgacgcatcacttgaaagcatggaggctttaaaaccggcattcaaacca
gatggaataataacagccggcaactcggccccactgaacgacggtgcatcaatggtaatg
ctcatgtctgagagggccatgaatgaatatggtttaaaaccaatggccagaatagttgat
tttgccgctgccggtgtcgatccgacgataatgggcgatggcccggtgcctgcaacaagg
aagatcctttcaaggaataaaatcgatccacaggatatagatctctgggagataaacgag
gcttttgccgttgttgttttaaacgctgtaaaatcatttaatctggatttaaaaaaggtc
aacatcaacggtggcggtatatcaataggccatccactgggtgcaacaggtgccagaata
gcaggtacacttgcaaggcagcttgctaataaaagaaagaggtatggcatagcaacgctg
tgcgtcggcggaggccagggatactcattgttaatggagcgtatctaa

DBGET integrated database retrieval system