KEGG   Picrophilus torridus: PTO1028Help
Entry
PTO1028           CDS       T00177                                 

Definition
(GenBank) NADH-quinone oxidoreductase chain M
  KO
K00342  NADH-quinone oxidoreductase subunit M [EC:1.6.5.3]
Organism
pto  Picrophilus torridus
Pathway
pto00190  Oxidative phosphorylation
pto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pto00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PTO1028
Enzymes [BR:pto01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     PTO1028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Proton_antipo_M Neurensin
Motif
Other DBs
NCBI-ProteinID: AAT43613
UniProt: Q6L089
Position
complement(1035325..1036806)
Genome map
AA seq 493 aa AA seqDB search
MISLLFLIFILTIIATAATYFIKRYHRAFGIISFFILFLIFAVYSILTFSSYHSGIMDAS
QFPLAVNKYIDIDFSIGLTGLTASLSAVAYIITIFALLISNMEDSISTGLIATAGLGLIG
LFISRDFLFFFIFWEIAILAVFFIIYRYGRLQRRSISIKFFIYMHVGSLFLLLGFFALAT
YYYIDFHIISFSFQQLLNYTFFSTIPAFGAGFIIFSLLLVFLIKLPIFPLHGWLADSYNS
APYSGTVMLAGGLGMMGGYGLFGIMYPLLINVLSHDVSYILIGLGILSLIYFSTASVFQE
SIKMMLAYLSAADLSFVLISFGVSLISHGKVSVLAASGGMYQIIAASFLITMAFASLFII
YKKTGTEMIYRLGGITRNAPFLAGFTLMAFVGILGLPGFTPFISEFSIIISSFQSIGAFS
IIIVIGLMIIAASLIWAAQRALFGPYNENLGSIKDLNKPEFLILLGLFALAVLSGIYPDI
FFKIISIYAGGVI
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgatatcattgctttttttaatattcatattaacaataattgcaactgctgcaacatac
ttcattaaaaggtatcacagggcttttggaataatatcattcttcattttattcttgatt
ttcgctgtttattctattttaacattttcatcctatcattcaggcataatggatgcatca
cagttcccgcttgcagttaataaatacatagacatagattttagcataggtttaaccggc
ttaacagcttcgctaagcgccgttgcatatataataacaatctttgcgcttttaatatca
aacatggaggatagtatatcaaccggtttgatagcaaccgcaggccttggtcttataggt
ctttttatctccagggactttcttttcttctttatattctgggagatagcaatacttgct
gttttctttataatttacaggtacggcaggctacagaggcgctcaatttcaataaagttc
tttatatacatgcatgttggctctctctttctattgcttggattctttgcacttgcaaca
tactattacatagattttcatataatatcattttcattccagcagcttctgaactataca
ttcttttcaacaatacctgcatttggcgccggttttataatattctcactgctcctggta
tttttaataaaattgccgatctttccattgcatggatggcttgcagattcatacaattca
gcgccatactctggaacggtgatgcttgcaggtggccttggtatgatggggggctatggt
ctattcggcataatgtacccacttttaataaacgtattatcgcatgatgtttcatatata
ttaataggccttggcatactgagtttaatatacttttcaacagcctctgttttccaggaa
agcattaagatgatgctggcatatctcagcgctgccgatctttcctttgtattgatttcc
tttggcgtttcattaatatcacatggaaaggttagtgtgcttgcagcgtccggtggcatg
taccagatcattgccgcatcgtttttaataacaatggcctttgcatctttgtttataatt
tataaaaagaccggaacagagatgatatacaggcttggtggcataacaagaaatgcgccc
ttccttgcaggattcacattaatggcatttgttggcatacttggtcttcctggttttaca
ccttttataagcgagttttccataattatatcatcgttccagagcattggcgctttttcc
ataataatagttataggccttatgataatagcagcctcactgatatgggcagcgcagagg
gctttgtttggcccttataacgagaaccttgggtccattaaggatctaaataaaccggag
ttccttatactccttggcctgtttgcgctggcagttctgtccggtatctatccggatata
tttttcaaaataataagtatttatgcgggtggtgttatatga

DBGET integrated database retrieval system