KEGG   Picrophilus torridus: PTO1045Help
Entry
PTO1045           CDS       T00177                                 

Definition
(GenBank) (S)-2-hydroxy-acid oxidase chain D
  KO
K00104  glycolate oxidase [EC:1.1.3.15]
Organism
pto  Picrophilus torridus
Pathway
pto00630  Glyoxylate and dicarboxylate metabolism
pto01100  Metabolic pathways
pto01110  Biosynthesis of secondary metabolites
pto01120  Microbial metabolism in diverse environments
pto01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PTO1045
Enzymes [BR:pto01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     PTO1045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD-oxidase_C FAD_binding_4
Motif
Other DBs
NCBI-ProteinID: AAT43630
UniProt: Q6L072
Position
1054990..1056384
Genome map
AA seq 464 aa AA seqDB search
MDIYNDLSRIIDPRIILNKTEEKIPFKNDASYISGSEPYLIVMPENVNDVSKVLKYCNDN
NINVVPRSGGTSLTGSSVVYHDGIVIDMLKMNKIKNLSLEDRYVVAEPGVRLDDLNIYLS
KYNFFYPPDPASSLAATVGGTLSTNAGGLRAVRYGTTKEWVLGLEIVLPDGSIIRTGEYT
LKRSAGYDLTALFLGSEGTLGIITSAVLKIAPLPEKVSRIMAFFKTIDDVGIAVSRIKKS
GITPLISEFLDRTSMEAVKNSVNLNIPENMNYMLILDIDSDLESIDRKSGDAIKIIKEIT
DKIEVTTDKKRMDEIYRARKGLYSSLLLNRENDRQIVVIGDVVFPASELPGALHEAENLI
KKYNLKVPLFGHIGDGNLHANIITDADEKSLEKVHRFQIELADIAIKHNGSVSAEHGIGL
EKNDLLYKEYRDRNNLKALELMREIKNTIDKNNIMNRGKIFYET
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggatatttacaatgatctttcaagaataatagatccaagaataatattaaacaaaact
gaagaaaaaattccgtttaaaaacgatgcatcatatatatcaggaagcgagccatatcta
atagtcatgcctgaaaatgtcaatgatgtatcaaaggttttaaaatattgcaatgataat
aatataaatgttgtgccaagatccggcggtacatctctaacaggttcaagtgtggtttac
catgacggaatagtcattgatatgttaaaaatgaacaaaataaaaaatctaagccttgag
gatagatacgtcgttgccgagccaggtgtaaggctcgatgatcttaatatttatctatca
aaatacaattttttttatccgccagaccctgcaagctcactggcagcaactgttggtggt
acattatcaacgaatgctggcggcctcagggccgtacgctatgggacaacaaaggaatgg
gttctcggacttgaaatagtattaccggatggtagcataataagaaccggtgagtacaca
ttaaagaggagtgcaggttatgatctgacagcattattccttggctctgagggcactctt
gggataataacatctgctgtattaaaaatagccccgctcccggagaaggtctcaaggata
atggccttttttaaaaccatagacgatgtcggcattgcagtatcaagaataaagaaaagc
ggcataacaccgttgatctctgaattcctggacaggacaagcatggaggccgttaaaaat
tcggtaaatttaaatatacctgaaaacatgaattacatgcttattctagatatagattct
gatcttgaatccattgacaggaaatcaggcgatgcaataaaaataataaaagaaataaca
gataaaatagaggttacaacagataaaaagagaatggatgaaatatacagggcaagaaag
ggtttatactcatcactgctgcttaacagggaaaacgacaggcagatcgttgtgatcggg
gatgttgtattccctgcttcagagcttccaggggcgcttcacgaggcagagaacctgatt
aaaaaatataatttgaaagtgccattattcgggcatatcggtgatggaaacctgcatgca
aatattataacagatgccgacgaaaaatctcttgaaaaagtgcatagattccagattgag
cttgcggatatagcaataaagcacaacggttcagtttctgcagagcacggtatcggcctt
gaaaagaacgatcttttatataaagaatacagggatagaaataatttaaaagccctggaa
ctcatgcgtgagattaaaaatacaattgataaaaataatataatgaacaggggtaagata
ttctatgaaacctga

DBGET integrated database retrieval system