KEGG   Picrophilus torridus: PTO1055Help
Entry
PTO1055           CDS       T00177                                 

Definition
(GenBank) transcriptional regulatory protein
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_24 HTH_AsnC-type MarR_2 HTH_45 MarR HTH_Tnp_ISL3 HTH_11
Motif
Other DBs
NCBI-ProteinID: AAT43640
UniProt: Q6L062
Position
complement(1069110..1069877)
Genome map
AA seq 255 aa AA seqDB search
MDEIDKRIIYYYLKDSRSSQRAISNELKISPQVLKYRFDKMVSSGIIKKFVLHIDPSLQN
LSKAFVAVKSRYDLKNIFAEISCLEEISIYGIYGTYDEIIGRIKDIKNKLGNLTMEYIPR
INDNINITPNDRLIIDELKKDPRKPASDIANDLNLSYKFVNRRIDYLMKKHLINVIPIID
LSMTDISILAIFSSRFNELKNIINDISIINVEDQNYGLAILLSENLLNAKAIIDKCRSVD
PNVNVMVVYNYSFYS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaatagacaagaggataatttactattatttaaaggacagtcgttcctcacag
agggcaatatcaaatgaattaaagatatcgccgcaggttttaaaatacagattcgataag
atggtttcatctggtataataaaaaaatttgtgctgcacattgatccgtcactgcaaaat
cttagcaaggccttcgttgcggttaaaagcaggtacgatttaaaaaatatctttgccgag
atatcatgccttgaggagataagtatttatggtatttacggaacatacgatgagataata
ggcagaataaaagatataaaaaataagcttggtaatttaacaatggaatacataccaaga
attaatgataatataaacataacacccaacgacaggttaataatagatgaattgaaaaag
gacccaagaaagcctgcatcagatatagcaaatgatcttaaccttagctataagttcgtt
aacaggcgaatagactatttaatgaaaaaacatttaataaacgtaataccaataatagat
ctatcaatgacggatatctcaatccttgcaatattctcatcaaggttcaatgagttaaaa
aatattataaatgatatatcaataataaacgttgaggatcaaaactacgggcttgcaatt
ctgctatctgaaaatcttttgaatgcaaaggccatcatagataaatgcagatctgttgat
ccaaatgtgaatgttatggtcgtttataattactcattttactcatga

DBGET integrated database retrieval system