KEGG   Picrophilus torridus: PTO1058Help
Entry
PTO1058           CDS       T00177                                 

Definition
(GenBank) sugar transporter
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 MFS_1_like MFS_3
Motif
Other DBs
NCBI-ProteinID: AAT43643
UniProt: Q6L059
Position
1071170..1072513
Genome map
AA seq 447 aa AA seqDB search
MINNDFEKINRFILSNDNRYGIFIIIIVSASIFLDVWDLTSLSFVLTFFKSYFSSAGGFL
IGISVASANIGAIAGSFLSPYMTESLGRRRMLLINMVIFIISAIVISISNNIIYVIIFRI
IMGFSIGNDVVTGFTYIYEYTSEKQRSSLYPLWAYAFSGVALLAILTVYILYYILPHYYL
WRSVFIIAALFALIILTLRYKLLETPLWLYKHGRNDQLEYVLENVYKKHIEIRSWFYYKP
NFYDMIRMFKNNEYLMLFTLSLNGIVGFIGWGFSFYVTYMLFELHVYSFESILAIDALIY
GFGLLGAISSRFLFKMYGSYRLSVTSSFIAAFCIMLLLLAFSGYINLITVIPLTILIIFF
NYLGPMAYNAVLNNNIDPMYRSQANGWNYMFNKIVEAISGLSAGIIIIEIGDVYNTLMLF
IIIMIFSVMALISGRYLKSDFQSSESL
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgattaacaatgattttgaaaagattaatagattcattttaagcaacgataacaggtat
ggcatttttattataataatagtttcagcaagcatatttcttgatgtctgggatctaaca
tcactgtcatttgttttaacattctttaaatcatacttttcatcagccggtggattttta
ataggtatttcagtggcatcggcaaatattggtgccatagccggttcatttttaagtcca
tacatgacggaatcccttggcagaaggagaatgcttttaataaacatggtaatttttatc
atatcggccattgtaatatcaatttcaaataatataatatatgttataatatttagaata
ataatgggatttagcataggcaatgatgttgttacaggctttacatatatatatgaatac
acaagcgaaaaacagagatcatcattgtatccactttgggcctatgcgttttcaggcgtt
gcactcctggcaattttaacagtttacatactttattatatcctgccgcattattatcta
tggagatcggttttcatcattgcagcactatttgcacttataatccttaccttgagatat
aaattgctcgagacgccattatggttatacaaacatggcaggaacgatcagcttgagtat
gtgctagagaacgtttataaaaagcatattgaaataagatcatggttttattacaaacca
aatttttatgatatgataaggatgttcaaaaacaatgaatatcttatgctttttacccta
tcattgaatggcatagttggattcattggctggggattttcattctatgttacctatatg
ctctttgaactgcatgtttactcatttgaatcaatacttgccattgatgcgttaatatac
ggctttggcctcctgggtgccatttcatcaagattcttatttaaaatgtatggatcttac
aggctttcagtaacatcatcatttatcgcggcattttgcataatgcttttgcttctggca
ttctccggatatattaatttaattaccgtgataccattaacaatattgataatattcttt
aattatcttggtccaatggcatacaatgcggtacttaacaataacatagatccaatgtac
aggagccaggcaaacggctggaattacatgtttaacaagattgtcgaggcaataagcggc
ctgtcagccggaataataataattgaaatcggtgatgtatataatacattaatgctgttt
ataataataatgattttttctgtaatggcattaatatcaggccgttatttaaaatccgat
ttccagagttcagaatcattataa

DBGET integrated database retrieval system