KEGG   Picrophilus torridus: PTO1071Help
Entry
PTO1071           CDS       T00177                                 

Definition
(GenBank) methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
pto  Picrophilus torridus
Pathway
pto00670  One carbon pool by folate
pto00720  Carbon fixation pathways in prokaryotes
pto01100  Metabolic pathways
pto01120  Microbial metabolism in diverse environments
pto01200  Carbon metabolism
Module
pto_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:pto00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PTO1071
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    PTO1071
Enzymes [BR:pto01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     PTO1071
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     PTO1071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH
Motif
Other DBs
NCBI-ProteinID: AAT43656
UniProt: Q6L046
Position
1081861..1082691
Genome map
AA seq 276 aa AA seqDB search
MIIDGVKISETKMERLKNEIEKIKNTGINPKMKIILIGNDYGSVVYSKAKMRRGSKLGID
VDLDRYDSISREDLIKLLKRYSQSDDIHGIMIETPVPGINYYDVVNEIPFYKDVDGMTSY
NLGNLYLKNEFIAPATARAVVDILDYINIKSGNVAIINRSPVVGRPLSMMLLNRDFTVTV
CHSRTVNINEITRSSDIVVVAVGKPNFLDRSYVSDKNIIIDVGINYLNGKTCGDADYENI
KDYVNAITPVPGGVGPVTATDIFENFINGLKYQIKG
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgattatagacggtgttaaaatatccgagacaaagatggaaaggcttaaaaatgagata
gaaaaaataaaaaataccggaataaatccaaaaatgaagattattttaataggaaacgac
tatggaagcgttgtttattcaaaagccaagatgaggcggggctcaaaacttggaatagat
gttgatttagatagatacgattcaatatcccgggaagatcttattaagcttttaaaaaga
tactctcaaagcgatgatatccatggaataatgatagaaacaccagtacctggcataaat
tactatgatgttgtaaatgaaataccattctacaaggacgttgatggcatgacgtcttat
aaccttggaaacctttacctaaaaaatgagttcattgcgcctgcaacagccagggctgtt
gttgacattcttgattatataaatataaaatccggtaacgttgcaataataaacagatct
cctgttgttggcaggcccttatcaatgatgctgttgaacagggacttcacggttacagta
tgccatagcaggacagtgaatataaacgagataacaaggtcatcagatatcgttgttgtt
gccgttggaaaaccaaacttccttgatagatcctatgtgtcagataaaaatataattata
gatgttggcataaactatctcaatggaaagacatgcggtgatgcagattatgaaaatata
aaggattatgttaatgcaataacgccggtgcctggtggcgtcgggccggttacggcaaca
gacatctttgaaaactttattaacggcctaaaataccagataaagggttaa

DBGET integrated database retrieval system