KEGG   Picrophilus torridus: PTO1072Help
Entry
PTO1072           CDS       T00177                                 

Definition
(GenBank) hypothetical membrane associated protein
  KO
K00389  putative membrane protein
Organism
pto  Picrophilus torridus
Brite
KEGG Orthology (KO) [BR:pto00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    PTO1072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF202 SdpI MscS_TM DUF3796 GRIM-19 DHHC Tetraspannin
Motif
Other DBs
NCBI-ProteinID: AAT43657
UniProt: Q6L045
Position
1082729..1083058
Genome map
AA seq 109 aa AA seqDB search
MSPSDHLANKRTFLSWVRTGIALMGFGFVIAKFEIFIHILIKSSISKSSIIPGEIMIVIG
IITIIYGLYEYLQNEKDLNENNYNPRNLESIVFSFAIIAMAIVLLLLII
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccatcagatcatcttgcaaacaaaagaacctttttatcatgggtaagaactgga
atagcattaatgggctttggttttgtcatagcaaaattcgagatctttatacatatatta
ataaagagcagcatatcaaaatcaagcataatccccggggagataatgattgtaattgga
ataataacaataatttacggcctttatgaatatttgcagaatgaaaaggatctcaatgaa
aacaattacaatccgagaaatctcgaatccattgtcttttcatttgcaataatagcaatg
gcaatcgtgctgttactattaataatttaa

DBGET integrated database retrieval system