KEGG   Picrophilus torridus: PTO1076Help
Entry
PTO1076           CDS       T00177                                 

Definition
(GenBank) DNA adenine methylase
  KO
K06223  DNA adenine methylase [EC:2.1.1.72]
Organism
pto  Picrophilus torridus
Pathway
pto03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pto00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    PTO1076
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pto03032]
    PTO1076
   03400 DNA repair and recombination proteins [BR:pto03400]
    PTO1076
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:pto02048]
    PTO1076
Enzymes [BR:pto01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     PTO1076
DNA replication proteins [BR:pto03032]
 Prokaryotic Type
  DNA Replication Termination Factors
   DNA methylation enzymes
    PTO1076
DNA repair and recombination proteins [BR:pto03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    Other MMR factors
     PTO1076
Prokaryotic defense system [BR:pto02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    PTO1076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MethyltransfD12 Cons_hypoth95 DASH_Dad4
Motif
Other DBs
NCBI-ProteinID: AAT43661
UniProt: Q6L041
Position
complement(1086197..1086928)
Genome map
AA seq 243 aa AA seqDB search
MNILIKYPGSKGSLLNDIKDVFNRSSCSRLVDVFGGSGIVLLNLDAGEKIYNDINLDLIN
LFKTLKYKYNDLYKMITALKNREVFDYYKYNIDSMGKNDVERAFKTFYLLNTTFGGQGNT
YIKHDKSKFNLVSRIINNMENLRINISSWIIENLDYKYLIEKYDGKNTFFYIDPPYNGKR
WYDFDIDSYKTLNSLISKMQGKYLMNFIRDDGIINIFGNPAFIRKYMSTGSSYRYYYFYT
NVR
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaatatattaataaaatatccaggatcaaagggctctctcttaaatgacataaaagac
gtttttaacaggtcatcatgctcaagattggttgatgtattcggcggctcaggtatagtt
ctgttaaacctcgatgcaggtgaaaagatatacaatgatataaacttggatcttataaat
ctctttaaaacattaaaatacaaatacaatgacctttataaaatgattacagcattaaag
aacagggaggtttttgattattataaatataatatagattccatgggtaaaaatgatgtg
gagagggcatttaaaacattttatttattaaacacaacatttggcggccagggaaatacc
tacataaaacatgataaatcaaaatttaaccttgtttcaaggataataaacaacatggaa
aatttgagaattaatatatcatcatggattattgaaaaccttgattataaatacttaata
gaaaaatatgatggtaaaaacacatttttttacatagatccgccatacaatggtaaaaga
tggtatgattttgatatagattcatacaaaacgttaaatagtttaatatcaaaaatgcag
ggtaaatacctcatgaattttataagggatgatggaattattaatatattcggcaatccg
gcctttataagaaagtatatgagcaccggaagttcatacagatattactatttttataca
aacgtgagatga

DBGET integrated database retrieval system