KEGG   Picrophilus torridus: PTO1092Help
Entry
PTO1092           CDS       T00177                                 

Definition
(GenBank) serine/threonine protein phosphatase
  KO
K01090  protein phosphatase [EC:3.1.3.16]
Organism
pto  Picrophilus torridus
Brite
KEGG Orthology (KO) [BR:pto00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PTO1092
Enzymes [BR:pto01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     PTO1092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos_2 Metallophos FBPase_2
Motif
Other DBs
NCBI-ProteinID: AAT43677
UniProt: Q6L025
Position
complement(1101759..1102442)
Genome map
AA seq 227 aa AA seqDB search
MKILIISDIHGNYDALSSINESYDKMIFLGDAVDYGPEPDRVMDFLRENSDINIMGNHDN
AVAYNQDCMCSFDMHDLSERTREKISMKLLGKNDIDYIKGFKSYAEINIDNKRFYATHGS
PMNNLNGYLFATEAEMLYKKREFMEKYDFILVGHTHFMMMYRNKIINPGSAGQPRDNNYM
PSYLLYDSRDNSFLFKRFNYNYENTLKKLKNLLDDDTYNKIKRFYSP
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccttattatatctgatatacatggtaattacgatgcattaagctctataaac
gaaagctatgataagatgatctttttaggtgatgccgttgattatgggcctgaacctgat
agagtcatggattttcttagagagaacagcgatatcaatataatgggaaaccatgataat
gccgttgcatataatcaggattgcatgtgctcttttgatatgcacgatctaagcgagagg
acccgggagaaaataagcatgaaacttctaggaaaaaacgatatagattacataaagggc
ttcaaaagttatgctgagataaatatagacaataaaagattctatgccacccatggaagc
ccgatgaacaacctaaatggatacctgtttgcaaccgaggctgaaatgttatacaaaaaa
agggaatttatggaaaaatatgattttatactggttggccacacgcacttcatgatgatg
taccgaaataaaataataaatccaggaagtgcaggccagccaagggataataattacatg
ccatcgtatttattatatgactcaagggataactcgtttttgtttaaaagatttaattac
aattatgaaaacacattaaagaagctaaagaatctgcttgacgatgatacatataataaa
ataaagcgcttttacagtccatag

DBGET integrated database retrieval system