KEGG   Picrophilus torridus: PTO1098Help
Entry
PTO1098           CDS       T00177                                 

Definition
(GenBank) putative ICC-like phosphoesterases
  KO
K06953  uncharacterized protein
Organism
pto  Picrophilus torridus
Brite
KEGG Orthology (KO) [BR:pto00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    PTO1098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos Metallophos_2
Motif
Other DBs
NCBI-ProteinID: AAT43683
UniProt: Q6L019
Position
1106853..1107587
Genome map
AA seq 244 aa AA seqDB search
MKDIRIDDNVYISNLYCAYLADIGAAVVSDLHLGFEDEMNLHGIFLPKLQFNHITKIIDN
IISRYNPEKIIINGDFKQEFSRNLPQEWDDINRFIDKYENDVSLIYIRGNHDNYLINILK
SRNIRIYNYYEDDHYYIYHGDRDLGIKKITILGHEHPSIALRDRVGGVFKIPAFVYNEEY
KVLITPAMSFFSSGTDVTQSLLSDEHFTPVLRNVSKKFRAYGITDEFGLLDFGYIEDISK
SMEI
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggacataagaatagatgataatgtttacatttcgaatttatactgtgcatacctg
gcagatataggtgccgctgtggtctctgatctgcaccttggcttcgaggatgagatgaat
cttcatggtatatttctgccaaagctgcagtttaaccatattacaaagataattgataat
ataatatcaaggtataatcctgaaaagatcattataaatggcgatttcaagcaggagttc
tcaagaaacctgccacaggaatgggatgatataaatagattcatagataaatatgaaaac
gatgtttcattaatctatataaggggaaaccatgataattatctaataaacatattaaaa
tcgaggaatataaggatttataattattacgaggacgatcattattatatataccatggt
gacagggatcttggcataaaaaagattacaattctgggtcatgagcatccatcaattgca
ctgagagaccgtgtcggtggtgtttttaagataccggcgtttgtctacaatgaggaatat
aaggttttaataacaccggcaatgagcttcttctcatcaggcacagatgtaacgcagtca
ttattaagtgatgagcacttcacgcccgttctcaggaacgtttcaaaaaaattcagggcc
tatggaataacagatgaattcggcctgcttgattttggctacatcgaggacatatcaaaa
agcatggagatataa

DBGET integrated database retrieval system