KEGG   Picrophilus torridus: PTO1399Help
Entry
PTO1399           CDS       T00177                                 

Definition
(GenBank) cytochrome P450
  KO
K00493  unspecific monooxygenase [EC:1.14.14.1]
Organism
pto  Picrophilus torridus
Pathway
pto00071  Fatty acid degradation
pto00380  Tryptophan metabolism
pto00627  Aminobenzoate degradation
pto01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    PTO1399
  Amino acid metabolism
   00380 Tryptophan metabolism
    PTO1399
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PTO1399
Enzymes [BR:pto01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     PTO1399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450 Glyco_tranf_2_5
Motif
Other DBs
NCBI-ProteinID: AAT43984
UniProt: Q6KZ68
Structure
PDB: 

Position
complement(1398572..1399603)
Genome map
AA seq 343 aa AA seqDB search
MRLNDPVHYDGAWHVYKYSDVKHVLMNDKIFSSNPGNRYSNAGGISFITMDNPEHKEFRD
ISAPYFLPSKINDYKDFIEETSNDLIKNIDNKDIISEYAVRLPVNIISKILGIPDSDMPL
FKLWSDYIIGNKRDENFNYVNNRMVSRLLEIFKSDSHGIINVLAGSSLKNRKLTMDEKIK
YIMLLIIGGNETTTNLIGNMIRVIDENPDIIDDALKNRSGFVEETLRYYSPIQFLPHRFA
AEDSYINNKKIKKGDQVIVYLGSANRDETFFDEPDLFKIGRREMHLAFGIGIHMCLGAPL
ARLEASIALNDILNHFKRIKIDYKKSRLLDNKMVLGYDKLFLS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagattaaatgacccggtgcactatgatggcgcatggcatgtttataaatacagtgat
gtaaaacatgttttgatgaacgataaaatattttcctcaaatccaggtaataggtattca
aatgccggtggtataagctttataacaatggataaccctgagcataaagaattcagggat
atatcagcaccgtactttttgccgtcaaagatcaatgattataaagattttatagaggaa
acctcaaatgatttaataaaaaatatagataacaaagatattatttcagagtatgctgtg
aggcttccggtaaatattatatcaaaaatacttggaatacctgattctgacatgccattg
tttaagctatggtctgattatataataggaaataaaagggatgagaacttcaattatgtt
aacaataggatggtttcaaggcttttagagatctttaaatctgattcacatggtataata
aatgtgctggcaggatcgtcattaaaaaatagaaaactaaccatggatgaaaagataaaa
tacataatgcttttaataataggcggaaacgagacaacaacaaaccttataggaaacatg
ataagggtaattgatgaaaaccctgatattattgacgatgcattaaaaaacagatcaggc
tttgttgaggaaactctaaggtattattcaccaatacagtttctaccgcataggtttgca
gcagaggattcttacataaacaataaaaaaataaaaaagggtgatcaggtaattgtttac
cttggctcggcaaacagggatgaaacattctttgatgagcccgatttatttaaaattggc
agaagggagatgcaccttgcctttggcataggaattcacatgtgtctcggggcaccgctt
gcaaggcttgaggcatcaatagcattaaatgatatattgaatcattttaaaaggataaaa
atagattataaaaaatccaggcttcttgataataaaatggttcttggctatgataagcta
tttctttcctga

DBGET integrated database retrieval system