KEGG   Picrophilus torridus: PTO1498
Entry
PTO1498           CDS       T00177                                 
Name
(GenBank) multi drug ABC transporter permease protein
  KO
K01992  ABC-2 type transport system permease protein
Organism
pto  Picrophilus torridus
Brite
KEGG Orthology (KO) [BR:pto00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pto02000]
    PTO1498
Transporters [BR:pto02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    PTO1498
SSDB
Motif
Pfam: ABC2_membrane_2 ABC2_membrane_3 ABC2_membrane
Other DBs
NCBI-ProteinID: AAT44083
UniProt: Q6KYW9
Position
1501182..1501994
AA seq 270 aa
MGNLYNVYMQYVKNYYRSKSFYLMLTLILVISILMTYFSLKYVNDLPAFLGRNVSFHLKK
ILFYFIWSFVLINIPVFSSVFFGSPAISSEIENKTAYYIFPLPINRYKLYIGKYLSAFTV
TFIIVLIYSSFEVIILHYLFGSIPLSFYYSIGLLAIFIFTILSITFMISSIFNKNTYAYI
TVFIIYYIVFEAGSLIINLLYKITPIYLLNEAADIVEKVYLNINTSSFVTSPSLAPATNT
EIYTSVLIMIIYMIISFVAGIIIFERKEVS
NT seq 813 nt   +upstreamnt  +downstreamnt
atgggcaatctatacaacgtttacatgcagtatgttaagaactattatagatccaagagc
ttttaccttatgctaacgcttatacttgttataagcattttaatgacctacttttcatta
aaatatgttaatgaccttccggcatttcttggcaggaacgtttcatttcatttaaagaag
atcctattctattttatatggtcctttgttttaataaatattccagtgttctcatcggtt
ttctttggatccccggcgatatcaagtgagatagagaacaaaactgcatattatatattc
ccgctgccgataaacaggtataaattatacataggaaaatatctatcagcattcaccgtg
acatttataatagttcttatatactcatcatttgaggtaataatactgcattatctcttt
ggatcgatacctttaagcttttactattcaataggccttcttgcaatcttcatttttaca
atactatcgataacatttatgataagctccatatttaataaaaatacatatgcatacata
acagtctttataatatattatatagtcttcgaggctggctctcttataataaatcttttg
tataaaataacaccgatatatcttctaaacgaggccgccgacatcgttgaaaaggtctat
cttaatataaacacatcaagctttgtaacatcaccaagtctggcaccggcaacaaatacc
gagatatatacttctgtgcttattatgataatatacatgataatctcctttgttgccggt
ataataatctttgaaagaaaggaggtatcataa

DBGET integrated database retrieval system