KEGG   Picrophilus torridus: PTO1499
Entry
PTO1499           CDS       T00177                                 
Name
(GenBank) multi drug ABC transporter ATP binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
pto  Picrophilus torridus
Brite
KEGG Orthology (KO) [BR:pto00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pto02000]
    PTO1499
Transporters [BR:pto02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    PTO1499
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_16 SMC_N AAA_13 AAA_22 AAA_23 AAA_30 AAA_27 AAA_29 Rad17 AAA_14 Mg_chelatase AAA_18 AAA ATP_bind_1 SRP54 T2SSE AAA_24 AAA_19 AAA_28 DO-GTPase2
Other DBs
NCBI-ProteinID: AAT44084
UniProt: Q6KYW8
Position
1501994..1502866
AA seq 290 aa
MEISIRNLTKRYGRILALNKINMHASGPGCIAILGPNGAGKTTMLKLISNIIKPTDGSVL
INNINVSDYPERALKYLGALIEQPEFYYYLNGYEILKFAAKVKGLKNNIDDEIKRLADLT
DMNDYLYRKTGTYSRGMKQRLALAVAMIGDPEIIILDEPTFGLDPKGMAYIRDLIKNLSR
EKLVILSTHLIYEAKEVSNRTLIIDHGEIKYDSINSDNKRKILVTFDGSISNIKSDFIRD
FVIDKNRIIITPREDADNYNIIYDLIKNGVKVNSAQDYDDLEETYISITS
NT seq 873 nt   +upstreamnt  +downstreamnt
atggagatctcgataaggaatttaacaaagaggtatggcagaattcttgcattaaataaa
ataaacatgcatgccagcgggccggggtgcatagcaatacttggtccaaacggtgcaggc
aaaacgacaatgttaaaattaatatcaaacattataaagccaacagatggaagcgttctg
ataaataatataaacgtctctgattatcctgaaagggcgttaaagtatctcggtgcgtta
atagagcagcccgaattttattactatttaaacggctatgagatattaaaattcgcggca
aaggtcaagggcttaaaaaataatattgatgatgagataaaaaggcttgcagatttaaca
gatatgaatgattacctttacagaaaaacaggaacctattcaaggggcatgaagcaaagg
cttgcacttgccgtggcaatgataggtgatccggagattataatccttgatgagcccaca
tttggcctggatccaaagggcatggcctatataagggatctaataaaaaatctttcaagg
gaaaagctggttatattaagcacgcatttaatctacgaggcaaaggaggtttcaaacagg
actcttataatagatcatggagagataaaatacgattcaattaacagcgataataaaaga
aagatccttgtaacatttgatggttcaataagtaatataaagagcgactttataagggat
tttgttatagacaaaaacaggataataataacaccaagggaggatgctgataattacaat
ataatatacgatttaataaagaacggcgtaaaggttaacagtgcacaggattatgatgac
cttgaggaaacatacatatcaataacatcctaa

DBGET integrated database retrieval system