KEGG   Planktomarina temperata: RCA23_c00610Help
Entry
RCA23_c00610      CDS       T03229                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase ThlA
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ptp  Planktomarina temperata
Pathway
ptp00071  Fatty acid degradation
ptp00072  Synthesis and degradation of ketone bodies
ptp00280  Valine, leucine and isoleucine degradation
ptp00310  Lysine degradation
ptp00362  Benzoate degradation
ptp00380  Tryptophan metabolism
ptp00620  Pyruvate metabolism
ptp00630  Glyoxylate and dicarboxylate metabolism
ptp00640  Propanoate metabolism
ptp00650  Butanoate metabolism
ptp00900  Terpenoid backbone biosynthesis
ptp01100  Metabolic pathways
ptp01110  Biosynthesis of secondary metabolites
ptp01120  Microbial metabolism in diverse environments
ptp01130  Biosynthesis of antibiotics
ptp01200  Carbon metabolism
ptp01212  Fatty acid metabolism
ptp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ptp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RCA23_c00610 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    RCA23_c00610 (thlA)
   00640 Propanoate metabolism
    RCA23_c00610 (thlA)
   00650 Butanoate metabolism
    RCA23_c00610 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RCA23_c00610 (thlA)
   00072 Synthesis and degradation of ketone bodies
    RCA23_c00610 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RCA23_c00610 (thlA)
   00310 Lysine degradation
    RCA23_c00610 (thlA)
   00380 Tryptophan metabolism
    RCA23_c00610 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RCA23_c00610 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RCA23_c00610 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RCA23_c00610 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptp04147]
    RCA23_c00610 (thlA)
Enzymes [BR:ptp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RCA23_c00610 (thlA)
Exosome [BR:ptp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RCA23_c00610 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AII85634
UniProt: A0A076K140
Position
65571..66749
Genome map
AA seq 392 aa AA seqDB search
MEDVYIVGAARTPMGGMQGALADASASQLGGVAIAAALAAGDVAPGDVDELLMGCVLPAG
QGQAPARQAGFAAGLGEDVPATTINKMCGSGMKTTMMGYDQLALGHGQVMVTGGMESMTQ
APYLLPKMRGGARLGHGQVQDSMFLDGLEDAYDTGRLMGTFAEDCAMHFQFSRAAQDAYA
LRSLERALAAQASGAVAAEIAPVTVAGRKAKVEVAMDEQPGTARPDKIPHLKPAFREGGT
VTAANSSSISDGAAALVLANATGLAAYGYTPRARVMGHASHAQAPGWFTTAPVPAARKLL
DRLGWSVADVDLWEVNEAFAVVPMAFMHEMELSPDVVNVYGGACALGHPIGASGARILVT
LLNALERHDLKRGVAAICIGGGEGTAIAIERM
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgtttatatcgtaggagcggcccgcacgccgatgggtgggatgcagggggct
ttggccgatgcatccgcgagtcagctgggcggtgtcgcgattgcagcggcgcttgctgcc
ggcgacgttgcaccgggtgatgtggatgagttgcttatgggctgcgtcttacccgctggg
cagggccaagcgccagcccgacaagcgggatttgctgcgggattgggagaagatgtcccc
gcaaccacgatcaacaagatgtgtggctcgggcatgaaaaccaccatgatggggtatgat
caattggcgttgggtcacggtcaggtgatggtcacgggcggcatggaaagtatgacccaa
gcgccctaccttttgcccaaaatgcgcggtggtgcgcggctgggacatggccaagtgcaa
gacagcatgtttctcgacggccttgaggatgcttatgacacagggcggttgatgggcact
tttgctgaggattgcgcgatgcattttcaattctcacgcgccgcacaagatgcttatgcg
ctgcgctccctcgagcgggcgttggccgcgcaggctagcggcgcggtcgcggccgaaatt
gccccggtgacagtggcggggcgcaaagcgaaggttgaggttgccatggatgagcaaccc
ggcactgcgcggccagataaaattccacatttgaaacccgcgttccgtgagggtggcacg
gtgacggcggccaattcttcgtcgatttctgatggggcggcggccttggttttggccaat
gccactggtcttgcggcctatggctataccccgcgggcgcgcgtaatgggccacgccagc
catgcacaagcgcccggttggtttaccaccgcccccgtgccagcggcccgaaaactgttg
gatcgtctcggctggagcgttgcggatgtagacttatgggaggtcaacgaggcctttgct
gtggtgcccatggcctttatgcatgagatggaactttctccggatgttgtaaatgtctat
ggcggtgcttgcgctttgggtcacccgatcggcgcctcgggcgcgcgaatcttggtaacc
ttgctaaacgctttggaacggcatgatctcaagcgcggtgttgcggcgatttgcatcggt
ggaggcgagggcactgccattgccattgaacgcatgtaa

DBGET integrated database retrieval system