KEGG   Planktomarina temperata: RCA23_c02820Help
Entry
RCA23_c02820      CDS       T03229                                 

Definition
(GenBank) putative ribulose bisphosphate carboxylase large chain
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
ptp  Planktomarina temperata
Pathway
ptp00630  Glyoxylate and dicarboxylate metabolism
ptp01100  Metabolic pathways
ptp01110  Biosynthesis of secondary metabolites
ptp01120  Microbial metabolism in diverse environments
ptp01130  Biosynthesis of antibiotics
ptp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ptp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RCA23_c02820
Enzymes [BR:ptp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RCA23_c02820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N LCIB_C_CA
Motif
Other DBs
NCBI-ProteinID: AII85846
UniProt: A0A076JVC9
Position
306661..307920
Genome map
AA seq 419 aa AA seqDB search
MTRLKATYEIESPVGVQRAAEVMAGEQSTGTFMRLASETDALRGRSAARLDHIEITGTSS
HPALPCRLSAENYEQGRVTISWPMENFGPSLPNILATVAGNLFELAELSAIRLVDLGIPN
ALATGCPGPQFGIAGTRQLMGVPSGPMIGTIVKPSVGLSAKQTAELVSDLAKADIDFIKD
DELQGNGPACPFADRAKLVMQVLNSAAQKSGRKVMYAFNITDEIDAMRRNIDLLESLGAT
CAMISLNSIGMAGLRAMRDHSPLPIHAHRNGWGLMSRSPHIGVAYSVMQKLWRLAGSDHL
HVNGLANKFTEDDDVVTNSARAVQAPLSEARPHVALPVFSSGQTAWQVGPSMELLGNDDF
LFCAGGGIMSHPDGPAAGITSLRQAAAAQKAGERVEDYAKDHPELAAALATFKSTVNRN
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtttgaaagcaacctatgaaatcgaaagccccgtgggcgtacagcgcgccgct
gaagttatggctggtgagcaatcgacaggcaccttcatgcgtctcgcatctgagaccgac
gcattgcgcggccgctccgcagcgcggttggatcatattgaaatcacgggcacctctagt
catcctgctttgccgtgtaggttaagtgctgagaactatgagcaaggccgcgtaaccatt
agttggccgatggaaaactttggcccgtccttgcccaatatccttgccactgttgcaggt
aatttatttgaactggccgaactttctgcgatccggcttgtggatcttggtatacctaat
gcgctggcaacagggtgtcctggccctcagtttgggatcgcaggcacgcgacagctgatg
ggagtgccaagcgggccgatgatcgggacgattgtaaagccgagcgttggattaagtgct
aagcaaacggccgaacttgttagtgatctggcgaaggcggacatcgatttcatcaaggat
gacgagttgcaaggcaacggacccgcatgcccgtttgctgatcgcgccaaattggtgatg
caggttttgaatagtgccgcgcaaaagtcagggcgcaaggtcatgtatgccttcaatatc
actgacgagattgacgcgatgcgtcgtaacattgacctgctcgaaagccttggtgcgacc
tgtgcaatgatatcgctaaactctatcggcatggctggcctgagggcgatgcgcgaccac
agcccgcttccgatccatgctcaccgcaatggatggggtttgatgtcgcgctcgccgcac
ataggggtcgcctattccgtaatgcaaaaactgtggcggttggcgggcagcgatcatttg
catgtgaacggtctcgccaacaagttcactgaggatgatgacgtcgttactaactccgcg
cgcgccgtgcaagcgcccctgagcgaggctaggccacacgtggctttaccggtattttcc
tctggtcaaaccgcgtggcaagtaggcccctcgatggaactgctcgggaatgacgatttt
ctgttctgcgcaggcggtgggatcatgagccatccggacggacccgctgcaggtattact
agtttacgccaagctgcagccgcacaaaaggcaggcgagcgagtggaagattacgccaaa
gatcaccctgagttagcggctgcgttggcaacatttaagagcactgtgaaccggaattag

DBGET integrated database retrieval system