KEGG   Planktomarina temperata: RCA23_c06710Help
Entry
RCA23_c06710      CDS       T03229                                 

Gene name
aldH
Definition
(GenBank) NADP-dependent fatty aldehyde dehydrogenase AldH
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
ptp  Planktomarina temperata
Pathway
ptp00040  Pentose and glucuronate interconversions
ptp00053  Ascorbate and aldarate metabolism
ptp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RCA23_c06710 (aldH)
   00053 Ascorbate and aldarate metabolism
    RCA23_c06710 (aldH)
Enzymes [BR:ptp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     RCA23_c06710 (aldH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh M20_dimer
Motif
Other DBs
NCBI-ProteinID: AII86229
UniProt: A0A076K2S9
Position
713447..714952
Genome map
AA seq 501 aa AA seqDB search
MLNGKHLIAGEWLDSDSTFSSQPAHGPAHNFTAGTAKLVQRACEAAEDSFWSYGYSSRET
RAAFLNRIADEIEAFGDQITEIGCQETGLPEARLIGERGRTVGQLRLFAEHVLKGDYLDR
RHDSALPDRQPLPRPELYMVQRPIGPVAIFGASNFPLAFSTAGGDTAAALAAGCPVVVKG
HSAHPGTGELVAQAIEKAVKAMDLHPGVFNLIQGGKRDVGAALVQHPLVRAVGFTGSLGG
GRALFDLCASREEPIPFFGELGSVNPMFLLPHSLSSRAEAMGEGWSSSLTMGAGQFCTNP
GIAVVQSGADAERFVAAATKALEQVGAQTMLTDGIAAAYRDGRDRIRANSSVQEILTTTC
DLRNATPYLFRVTAREWLANDVLAEEVFGPLGLVVEAEDAAEMTAVAKGLKGQLTCTVHM
NEDDTAQAQALMPILERKAGRVLVNGFPTGVEVSDTMVHGGPYPASTNFGATSVGTLSIR
RFLRPVCFQNMPEALLPQDLK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacggaaaacatctaattgccggcgaatggctcgacagcgacagcaccttttct
tcacagcctgcacatggtccggctcataattttaccgcgggaaccgcgaaactcgtgcag
cgcgcctgtgaagcggctgaagactcgttctggtcctacggttattccagtcgggaaaca
cgtgcggccttcctgaaccggatcgccgacgagatcgaagcgtttggcgaccaaatcact
gagattggctgtcaggaaaccggtctgcccgaagcgcggttgatcggagaacgcggtcgg
actgtcggccagctgcgcttgttcgcggagcatgttctgaaaggcgattatctggaccgt
cgccatgacagcgccttgcctgaccggcagccactgccgcggcctgagctgtatatggtt
cagcggcccatcggcccggttgcgatctttggtgcttcgaattttccacttgccttctcg
accgcagggggtgacacagcagcagcattggccgcaggctgccctgtagtggtcaaaggc
cactcagcgcacccgggaacgggggagctggtggctcaagcaatcgagaaggccgtgaag
gcgatggatctgcaccctggcgtgttcaacctgatccaaggaggcaagcgggacgtagga
gccgcgctggttcagcatccattggttagggcggttggctttaccggttcgctgggcggc
gggcgggcactgttcgatctgtgcgcatcccgcgaagagcctatcccgttctttggcgaa
cttggctcagtcaatccgatgttcctgctgccacattctctctcttcccgtgctgaggca
atgggcgagggctggtccagctccttgactatgggagccggacagttctgcaccaatccg
ggtattgccgtcgtgcagtcgggtgcagatgccgagcgttttgtcgcggcagctaccaag
gcattggagcaggttggcgcgcagacaatgctgactgacgggatcgccgcagcctatcgc
gatgggcgcgaccggatccgcgccaattccagcgtgcaggaaatcctcaccaccacctgc
gacctgcgcaatgcaacgccgtaccttttccgcgtcactgcgcgtgagtggttggcaaat
gatgtgttggccgaggaagtcttcggtccgctgggcctggttgtcgaagcagaagatgcg
gccgaaatgaccgctgtcgcgaagggacttaaagggcagctgacctgcaccgtccatatg
aatgaagacgacaccgcccaggcgcaggccttgatgccaatccttgagcgcaaggcgggg
cgagttttggtcaacggctttccgaccggcgtcgaagtatctgacacgatggtccatggc
ggcccctatccggcctcgacaaattttggtgcgacctcggtgggcactctgtcgatccga
cgtttccttcggcctgtgtgcttccaaaacatgccagaggcactgctgcctcaagatctg
aaatga

DBGET integrated database retrieval system