KEGG   Planktomarina temperata: RCA23_c25300Help
Entry
RCA23_c25300      CDS       T03229                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ptp  Planktomarina temperata
Pathway
ptp00010  Glycolysis / Gluconeogenesis
ptp00053  Ascorbate and aldarate metabolism
ptp00071  Fatty acid degradation
ptp00280  Valine, leucine and isoleucine degradation
ptp00310  Lysine degradation
ptp00330  Arginine and proline metabolism
ptp00340  Histidine metabolism
ptp00380  Tryptophan metabolism
ptp00410  beta-Alanine metabolism
ptp00561  Glycerolipid metabolism
ptp00620  Pyruvate metabolism
ptp00625  Chloroalkane and chloroalkene degradation
ptp00903  Limonene and pinene degradation
ptp01100  Metabolic pathways
ptp01110  Biosynthesis of secondary metabolites
ptp01120  Microbial metabolism in diverse environments
ptp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ptp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCA23_c25300
   00053 Ascorbate and aldarate metabolism
    RCA23_c25300
   00620 Pyruvate metabolism
    RCA23_c25300
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RCA23_c25300
   00561 Glycerolipid metabolism
    RCA23_c25300
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RCA23_c25300
   00310 Lysine degradation
    RCA23_c25300
   00330 Arginine and proline metabolism
    RCA23_c25300
   00340 Histidine metabolism
    RCA23_c25300
   00380 Tryptophan metabolism
    RCA23_c25300
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RCA23_c25300
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RCA23_c25300
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RCA23_c25300
Enzymes [BR:ptp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     RCA23_c25300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AII88048
UniProt: A0A076K746
Position
complement(2677789..2679228)
Genome map
AA seq 479 aa AA seqDB search
MTVDTSNLGKFYIAGQWVAPRSQANMPVLNPANERQIGIVPLGDAADVDAAVAAAVSAFP
AYSQTRKSERVALLQSLMKVTQSRFEDLAQAMRMEMGAPITMAREAQADAAIGHLQGFMD
ALAELVERETLSNGDILLREPIGVCGLITPWNWPMNQIALKVIPALATGCCCVLKPSEHT
PISAMIYAEIIDAAAFPPGVFNLVQGDGPTVGAALSRHKDVQMMSFTGSTRAGTAVTRDA
AETVKRVTLELGGKSPNLVFADCDLEAQVSASVAECMYNTGQSCDAPTRLLAERSCYEAV
LEIAKRAAEATEVGDPAQEGAHIGPLFDRIQFDRVQAMIKVGLEEGARLLAGGLGRPEGI
DAGWFVKPTIFCDVSNDMRIAQEEIFGPVLVIIPFEDEAEAIEIANDTPYGLAAYLQTGD
PARAERVAARLRAGAIHINGGGFNYGSPFGGYKQSGNGREGGMMGLEDYLETKTLHGLG
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcgacacaagcaatctaggtaagttttacatcgccgggcagtgggtggcgccg
agatcacaggccaatatgcccgttttaaaccccgccaatgagcgccagatcggcatcgtg
cccttgggggatgcggcagatgtggacgcggcggttgcggcggcggtgtcggcctttccg
gcctatagccagacgcgcaaatctgaacgtgtggctcttcttcaaagcttgatgaaggtg
acccagagcaggtttgaagatttggcgcaggcgatgcgcatggagatgggcgcgccgatc
accatggcccgcgaggcgcaggccgatgccgccatcggtcatttgcagggtttcatggac
gcattggccgagttggtggaacgggaaactttgagcaatggggacattcttttacgcgag
ccgattggggtgtgcggattaatcaccccttggaattggccgatgaaccaaattgccttg
aaggtcatcccggccttggcgacgggctgttgctgcgttttgaaaccctctgagcatacg
ccaatctctgcgatgatatacgctgaaattatagatgcggcggcctttccgcccggtgtg
ttcaatttggtccagggcgatggcccaacggtgggcgcggccctgtcgcgccacaaggat
gtgcagatgatgtcatttaccggttccacccgtgccgggacggctgtgacccgtgatgcg
gcagaaaccgtcaagcgtgtgaccttggagcttggtggcaaatcgcccaatctggtgttt
gccgattgtgaccttgaggcccaggtgagtgcctcggtcgccgaatgcatgtataacacg
gggcaatcttgcgacgcgccaacccggctattggccgagcgcagctgctatgaggctgtg
cttgagattgccaaacgcgcggcagaggccaccgaggtgggagatccggcgcaagagggc
gcgcatattggcccgctgtttgaccgtatccaatttgatcgggtgcaagccatgattaaa
gtggggcttgaggagggcgcacgcctcttggctggtggcttgggacgtcctgaggggatt
gatgccggctggtttgtgaagcccactattttttgtgatgtgtcaaatgatatgcggatt
gcgcaggaggaaatctttggtcctgttttggtcatcattcccttcgaggatgaggctgag
gcgattgaaatcgccaatgatacgccctatgggctggcggcctacctgcaaactggtgat
ccggcacgcgcggaacgtgtcgcggcccgcctcagggctggtgcgatccacatcaatggc
ggcggcttcaattatggctcaccctttggggggtataaacaatccggaaatggccgagaa
ggtggtatgatgggattggaagattaccttgaaaccaaaacgctgcacggattaggctag

DBGET integrated database retrieval system