KEGG   Psychroflexus torquis: P700755_000390Help
Entry
P700755_000390    CDS       T02275                                 

Definition
(GenBank) phosphatidylserine decarboxylase Psd
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
ptq  Psychroflexus torquis
Pathway
ptq00564  Glycerophospholipid metabolism
ptq01100  Metabolic pathways
ptq01110  Biosynthesis of secondary metabolites
Module
ptq_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:ptq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    P700755_000390
Enzymes [BR:ptq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     P700755_000390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase DUF986 CsgF DUF4131 DUF3328
Motif
Other DBs
NCBI-ProteinID: AFU67414
UniProt: K4IAF5
Position
408574..409227
Genome map
AA seq 217 aa AA seqDB search
MFHREGYKILVSSLIGLIVINLLSNLLINKQWIVTTIFLATLVMFILVAQFFRNPKRHVK
KNKKNILSPVDGKVVAIEKVFEPEFVNEERLQVSIFMSPLNVHVTRYPIGGKILYTKYHP
GKFFVAWHPKSSEENERTTVVVETQNFGNILFRQIAGAVARRIVNYAKEDKIAVQGEDSG
FIKFGSRVDLFLPVDSEISVSINDNVKGGESIILKAK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtttcatagagaaggttataaaattttagtttcgagtttgattggattaattgttatt
aatcttctgtcaaacctgcttataaataaacagtggattgtgaccacaattttcttggcc
acacttgtcatgtttattcttgttgcacagtttttcagaaacccaaagcggcatgtgaaa
aagaataaaaaaaatatcttatcgccagtcgatggcaaagttgtcgctatagaaaaagta
tttgagccagaatttgtaaacgaagagcgcttacaggtatctatatttatgtctccatta
aatgtccacgtaaccagatatcccattggtggtaaaattttatatacaaaatatcaccct
ggtaaattttttgtcgcttggcatccaaagtctagtgaagaaaacgagaggaccacggtt
gttgttgagacacaaaattttggaaatattttatttagacaaatagcaggtgctgtagca
agacgaattgtaaactatgctaaggaagacaaaatagcagttcagggagaggattctgga
tttataaaatttggatcaagagttgatttatttctacctgtggattcagaaatttctgta
tctatcaacgataatgtgaaaggtggggaatctatcattttaaaagccaagtaa

DBGET integrated database retrieval system