KEGG   Psychroflexus torquis: P700755_002554Help
Entry
P700755_002554    CDS       T02275                                 

Definition
(GenBank) tryptophan synthase beta chain TrpB
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ptq  Psychroflexus torquis
Pathway
ptq00260  Glycine, serine and threonine metabolism
ptq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ptq01100  Metabolic pathways
ptq01110  Biosynthesis of secondary metabolites
ptq01130  Biosynthesis of antibiotics
ptq01230  Biosynthesis of amino acids
Module
ptq_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P700755_002554
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    P700755_002554
Enzymes [BR:ptq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     P700755_002554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFU69307
UniProt: K4IFJ2
Position
2747662..2748846
Genome map
AA seq 394 aa AA seqDB search
MSKYSANDKGFYGDFGGAYIPELLYPNVEELRQNYKQIIATDDFQKQFKSLLKDYVGRPT
PLYLAENLSEKYKAKIYLKREDLCHTGAHKINNTVGQILLAKALGKHRIIAETGAGQHGV
ATATVCALMGLECIVYMGAVDIERQAPNVARMKMLGATVVPANSGSKTLKDATNEAIRDW
INHPRDTHYIIGSVVGPHPYPDMVTQLQSVISKEVKTQLLEKEGRELPDYLIACVGGGSN
AAGLFADFMDHEEVGIIGVEASGKGVETNESAATTILGREGIIHGSKTLLMQNTDGQITE
PYSISAGLDYPGIGPMHANLYKTGRGKFVSITDAEAMEAGLELSRIEGIIPAIETAHAFA
IFKYLDFKEDDVLVFNCSGRGDKDLDTYRTYFGY
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagtatagcgcgaatgacaaaggattttatggtgattttgggggggcttacatc
ccagaattattatatcctaatgtggaagaattaagacaaaactataaacagattattgct
acggatgattttcagaagcaatttaaaagtctattaaaagactacgtagggcggccaacg
cctttatatctagctgaaaatctcagcgaaaagtacaaggctaagatatacctgaagcgt
gaagatttatgtcacaccggcgcacataaaatcaataacaccgtagggcagatcctactt
gctaaggcattgggcaagcaccgcattatcgcggagacaggagcaggccagcatggggtg
gcaacagctacggtttgtgcattgatgggactggagtgtatcgtctatatgggagctgtc
gacatcgagcgtcaagcccctaacgtggcgaggatgaaaatgttgggagcgacggttgtc
ccagcgaattcaggaagtaaaaccttgaaagatgctactaacgaagcaattcgggattgg
attaaccatcctagagatacccattacattatcggttctgtggtaggaccgcatccgtat
cccgatatggtcactcagttgcaaagtgttatttccaaggaagtcaaaacgcagttgcta
gagaaggaaggtcgagaattaccagattacctcatcgcctgtgttggaggggggagtaat
gctgcgggattgtttgcggattttatggatcacgaagaggtagggatcatcggtgtagaa
gcctctgggaaaggagtggagacaaatgagtctgcggcgacaactattttaggtcgagaa
ggcatcatccacgggagtaaaaccttgctgatgcaaaataccgatggacaaatcaccgag
ccgtattctatttctgcaggactggactacccagggattggacctatgcacgcgaatctc
tataaaacggggcgtgggaaatttgtctctattactgatgcagaagctatggaagcaggc
ttagagttgagtcgtatagaagggattatccctgcgatagaaacggcacatgcttttgcg
attttcaagtatttggatttcaaagaagacgatgtgttggtctttaattgctcaggacgt
ggcgataaagatttagatacctacagaacgtatttcggatattaa

DBGET integrated database retrieval system