KEGG   Pan troglodytes (chimpanzee): 100608597Help
Entry
100608597         CDS       T01005                                 

Gene name
GUCY1A1
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-1 isoform X1
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00230  Purine metabolism
ptr01100  Metabolic pathways
ptr04022  cGMP-PKG signaling pathway
ptr04270  Vascular smooth muscle contraction
ptr04540  Gap junction
ptr04611  Platelet activation
ptr04713  Circadian entrainment
ptr04730  Long-term depression
ptr04921  Oxytocin signaling pathway
ptr04924  Renin secretion
ptr04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100608597 (GUCY1A1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100608597 (GUCY1A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100608597 (GUCY1A1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100608597 (GUCY1A1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100608597 (GUCY1A1)
   04924 Renin secretion
    100608597 (GUCY1A1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100608597 (GUCY1A1)
  09154 Digestive system
   04970 Salivary secretion
    100608597 (GUCY1A1)
  09156 Nervous system
   04730 Long-term depression
    100608597 (GUCY1A1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100608597 (GUCY1A1)
Enzymes [BR:ptr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100608597 (GUCY1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 100608597
NCBI-ProteinID: XP_003310595
Ensembl: ENSPTRG00000016541
VGNC: 49078
UniProt: A0A2J8MUU7
Position
4
AA seq 690 aa AA seqDB search
MFCTKLKDLKITGECPFSLLAPGQVPNESSEEAAGSSESCKATVPICQDIPEKNIQESLP
QRKTSRSRVYLHTLAESICKLIFPEFERLNVALQRTLAKHKIKESRKSLEREDFEKTIAE
QAVAAGVPVEVIKESLGEEVFKICYEEDENILGVVGGTLKDFLNSFSTLLKQSSHCQEAG
KRGRLEDASILCLDKEDDFLHVYYFFPKRTTSLILPGIIKAAAHVLYETEVEVSLMPPCF
HNDCSEFVNQPYLLYSIHVKSTKPSLSPSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQ
FGNGIRRLMNRRDFQGKPNFEEYFEILTPKINQTFSGIMTMLNMQFVVRVRRWDNSVKKS
SRVMDLKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQAR
AQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNV
TMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHK
ESDTHAVQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNN
VTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFTPRSREELPPNFPSEIPGICHFLDAY
QQGTNSKPCFQKKDVEDGNANFLGKASGID
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgttctgcacgaagctcaaggatctcaagatcacaggagagtgtcctttctccttactg
gcaccaggtcaagttcctaacgagtcttcagaggaggcagcaggaagctcagagagctgc
aaagcaaccgtgcccatctgtcaagacattcctgagaagaacatacaagaaagtcttcct
caaagaaaaaccagtcggagccgagtctatcttcacactttggcagagagtatttgcaaa
ctgattttcccagagtttgaacggctgaacgttgcacttcagagaacattggcaaagcac
aaaataaaagaaagcaggaaatctttggaaagagaagactttgaaaaaacaattgcagag
caagcagttgcagcaggagttccagtggaggttatcaaagaatctcttggtgaagaggtt
tttaaaatatgttacgaggaagatgaaaacatccttggggtggttggaggcacccttaaa
gattttttaaacagcttcagtacccttctgaaacagagcagccattgccaagaagcagga
aaaaggggcaggcttgaggacgcctccattctatgcctggataaggaggatgattttcta
catgtttactacttcttccctaagagaaccacctccctgattcttcccggcatcataaag
gcagctgctcacgtattatatgaaacggaagtggaagtgtcgttaatgcctccctgcttc
cataatgattgcagcgagtttgtgaatcagccctatttgttgtactccattcacgtgaaa
agcaccaagccatccctgtcccccagcaaaccccagtcctcgctggtgattcccacatcg
ctgttctgcaagacatttccattccatttcatgtttgacaaagatatgacaattctgcaa
tttggcaatggcatcagaaggctgatgaacaggagagactttcaaggaaagcctaatttt
gaagaatactttgaaattctgactccaaaaatcaaccagacgtttagcgggatcatgact
atgttgaatatgcagtttgttgtacgagtgaggagatgggacaactctgtgaagaaatct
tcaagggttatggacctcaaaggccaaatgatctacattgttgaatccagtgcaatcttg
tttttggggtcaccctgtgtggacagattagaagattttacaggacgagggctctacctc
tcagacatcccaattcacaatgcactgagggatgtggtcttaataggggaacaagcccga
gctcaagatggcctgaagaagaggctggggaagctgaaggctacccttgagcaagcccac
caagccctggaggaggagaagaaaaagacagtagatcttctgtgctccatatttccctgt
gaggttgctcagcagctgtggcaagggcaagttgtgcaagccaagaagttcagtaatgtc
accatgctcttctcagacatcgttgggttcactgccatctgctcccagtgctcaccgctg
caggtcatcaccatgctcaatgcactgtacactcgcttcgaccagcagtgtggagagctg
gatgtctacaaggtggagaccattggcgatgcctattgtgtagctgggggattacacaaa
gagagtgatactcatgctgttcagatagcgctgatggccctgaagatgatggagctctct
gatgaagttatgtctccccatggagaacctatcaagatgcgaattggactgcactctgga
tcagtttttgctggcgtcgttggagttaaaatgccccgttactgtctttttggaaacaat
gtcactctggctaacaaatttgagtcctgcagtgtaccacgaaaaatcaatgtcagccca
acaacttacagattactcaaagactgtcctggtttcgtgtttacccctcgatcaagggag
gaacttccaccaaacttccctagtgaaatccccggaatctgccattttctggatgcttac
caacaaggaacaaactcaaaaccatgcttccaaaagaaagatgtggaagatggcaatgcc
aattttttaggcaaagcatcaggaatagattag

DBGET integrated database retrieval system