KEGG   Pan troglodytes (chimpanzee): 100609964Help
Entry
100609964         CDS       T01005                                 

Gene name
CACNG5
Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04260  Cardiac muscle contraction
ptr04261  Adrenergic signaling in cardiomyocytes
ptr04921  Oxytocin signaling pathway
ptr05410  Hypertrophic cardiomyopathy (HCM)
ptr05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
ptr05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100609964 (CACNG5)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100609964 (CACNG5)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100609964 (CACNG5)
   04261 Adrenergic signaling in cardiomyocytes
    100609964 (CACNG5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100609964 (CACNG5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100609964 (CACNG5)
   05414 Dilated cardiomyopathy (DCM)
    100609964 (CACNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ptr04040]
    100609964 (CACNG5)
Ion channels [BR:ptr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100609964 (CACNG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 SUR7 COPI_assoc DUF716 AgrD DUF4199 DHHC
Motif
Other DBs
NCBI-GeneID: 100609964
NCBI-ProteinID: XP_003315735
Ensembl: ENSPTRG00000009559
VGNC: 12034
UniProt: A0A2J8KKE8
Position
17
AA seq 275 aa AA seqDB search
MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVIVPQNQSTEIKMSLHSGLWR
VCFLAGEERGRCFTIEYVMPMNTQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILNNI
GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAETYFNYKYGWSFA
FAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWVRG
RSPSDISSEASLQMNSNYPALLKCPDYDQMSSSPC
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcctgcgggaggaaggccctgaccctgctgagcagcgtctttgctgtctgtggc
ttgggcctcctgggtatcgcggtcagcaccgactactggctgtacctggaggagggtgtg
attgtgccccagaaccagagcaccgagatcaagatgtccctgcactcaggcctctggcgg
gtctgcttccttgcaggtgaggagcgggggcgttgcttcaccatagaatatgtgatgccc
atgaacacccagctgacatccgagtccacggtcaatgttctaaagatgatccgctcagcc
acaccattccctctggtcagcctcttcttcatgttcattgggtttatcctgaacaacatc
ggacacatccgtccccaccggacgatactggcctttgtctctggcatcttctttatcctc
tcaggcctctctctcgtggtgggcctggtgctctacatctccagcatcaacgatgagatg
ctcaacaggaccaaggatgcagagacctacttcaactacaagtatgggtggtcgtttgcc
ttcgccgccatctccttccttttaacggagagtgccggggtgatgtctgtgtacctgttt
atgaagcggtacaccgcggaggacatgtacaggccccaccctggcttctaccgccctcgg
ctgagcaactgctccgattactcaggccagttcctacacccagacgcctgggtcaggggc
cgcagcccctccgacatctccagcgaggcctccctgcagatgaacagcaactaccccgcc
ttgctcaagtgccccgactatgatcagatgtcctcttcaccctgctga

DBGET integrated database retrieval system