KEGG   Pan troglodytes (chimpanzee): 450579Help
Entry
450579            CDS       T01005                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00010  Glycolysis / Gluconeogenesis
ptr00562  Inositol phosphate metabolism
ptr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    450579 (MINPP1)
   00562 Inositol phosphate metabolism
    450579 (MINPP1)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     450579 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     450579 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708 SID
Motif
Other DBs
NCBI-GeneID: 450579
NCBI-ProteinID: XP_009457181
Ensembl: ENSPTRG00000002715
VGNC: 5522
UniProt: H2Q277
Position
10
AA seq 487 aa AA seqDB search
MRRAPGCLLRTSVAPAAALAAALLSSLARCSVLEPRDPVASSLSPYFGTKTRYEDVNPVL
LSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTAKQIRKLRQLHGLLQARGSRDGGAS
STGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLI
TSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCKKFLTEVE
KNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSP
WCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPV
SSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLY
HCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARA
NSTSDEL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgtgcgcccggctgcctcctccggacctccgtagcgcctgccgcggccctggct
gcggcgctgctctcgtcgcttgcgcgctgctctgttctagagccgagggacccggtggcc
tcgtcgctcagcccctatttcggcaccaagactcgctacgaggatgtcaaccccgtgcta
ttgtcgggtcccgaggctccgtggcgggaccctgagctgctggaggggacctgcaccccg
gtgcagctggtcgccctcattcgccacggcacccgctaccccacggccaaacagatccgc
aagctgaggcagctgcacgggttgctgcaggcccgcgggtccagggatggcggggctagt
agtaccggcagccgcgacctgggtgcagcgctggccgactggcctttgtggtacgcggac
tggatggacgggcagctagtagagaagggacggcaggatatgcgacagctggcgctgcgt
ctggcctcgctcttcccggcccttttcagccgtgagaactacggccgcctgcggctcatc
accagttccaagcaccgctgcatggatagcagcgccgccttcctgcaggggctgtggcag
cactaccaccctggcttgccgccgcccgacgtcgcagatatggagtttggacctccaaca
gttaatgataaactaatgagattttttgatcactgtaagaagtttttaactgaagtagaa
aaaaatgctacagctctttatcatgtggaagccttcaaaactggaccagaaatgcagaac
attttaaaaaaagttgcagctactttgcaagtgccagtaaatgatttaaatgcagattta
attcaagtagcctttttcacctgttcatttgacctggcaattaaaggtgttaaatctcct
tggtgtgatgtttttgacatagatgatgcaaaggtattagaatatttaaatgatctgaaa
caatattggaaaagaggatatgggtatactattaacagtcgatccagctgcaccttgttt
caggatatctttcagcacttggacaaagcagttgaacagaaacaaaggtctcagccagtt
tcttctccagtcatcctccagtttggtcatgcagagactcttcttccactgctttctctc
atgggctacttcaaagacaaggaacccctaacagcgtacaattacaaaaaacaaatgcat
cggaagttccgaagtggtctcattgtaccttatgcctcgaacctgatatttgtgctttac
cactgtgaaaatgctaagactcctaaagaacaattccgagtgcaaatgttattaaatgaa
aaggtgttacctttggcttactcacaagaaactgtttcgttttatgaagatctgaagaac
cactacaaggacatccttcagagttgtcaaaccagtgaagaatgtgaattagcaagggct
aacagtacatctgatgaactatga

DBGET integrated database retrieval system