KEGG   Pan troglodytes (chimpanzee): 450650Help
Entry
450650            CDS       T01005                                 

Gene name
PGAM1
Definition
(RefSeq) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00010  Glycolysis / Gluconeogenesis
ptr00260  Glycine, serine and threonine metabolism
ptr01100  Metabolic pathways
ptr01200  Carbon metabolism
ptr01230  Biosynthesis of amino acids
ptr04922  Glucagon signaling pathway
ptr05230  Central carbon metabolism in cancer
Module
ptr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ptr_M00002  Glycolysis, core module involving three-carbon compounds
ptr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    450650 (PGAM1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    450650 (PGAM1)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    450650 (PGAM1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    450650 (PGAM1)
Enzymes [BR:ptr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     450650 (PGAM1)
Membrane trafficking [BR:ptr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    450650 (PGAM1)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   450650 (PGAM1)
  Exosomal proteins of melanoma cells
   450650 (PGAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 450650
NCBI-ProteinID: NP_001233414
Ensembl: ENSPTRG00000002807
VGNC: 12419
UniProt: G2HJI9
Position
10
AA seq 254 aa AA seqDB search
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQ
KRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYD
VPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKR
VLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVR
KAMEAVAAQGKAKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctacaaactggtgctgatccggcacggcgagagcgcatggaacctggagaac
cgcttcagcggctggtacgacgccgacctcagcccggcgggccacgaggaggcgaagcgc
ggcgggcaggcgctacgagatgctggctatgagtttgacatctgcttcacctcagtgcag
aagagagcgatccggaccctctggacagtgctagatgccattgatcagatgtggctgcca
gtggtgaggacttggcgcctcaacgagcggcactatgggggtctaaccggtctcaataaa
gcagaaactgctgcaaagcatggtgaggcccaggtgaagatctggaggcgctcctatgat
gtcccaccacctccgatggagcccgaccatcctttctacagcaacatcagtaaggatcgc
aggtatgcagacctcacagaagatcagctaccctcctgtgagagtctgaaggatactatt
gccagagctctgcccttctggaatgaagaaatagttccccagatcaaggaggggaaacgt
gtactgattgcagcccatggcaacagcctccggggcattgtcaagcatctggagggtctc
tctgaagaggctatcatggagctgaacctgcccactggtattcccattgtctatgaattg
gacaagaacttgaagcctatcaagcccatgcagtttctgggggatgaagagacggtgcgc
aaagccatggaagctgtggctgcccagggcaaggccaagaagtga

DBGET integrated database retrieval system