KEGG   Pan troglodytes (chimpanzee): 451373
Entry
451373            CDS       T01005                                 

Gene name
ACY3
Definition
(RefSeq) N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming)
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    451373 (ACY3)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     451373 (ACY3)
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-GeneID: 451373
NCBI-ProteinID: XP_009421849
Ensembl: ENSPTRG00000003973
VGNC: 3231
UniProt: H2Q496 A0A6D2XTZ5
Position
11
AA seq 319 aa
MCSLPVPREPLRRVAVTGGTHGNEMSGVYLARHWLHAPAELQRASFSAVPVLANPAATSG
CRRYVDHDLNRTFTSSFLNSRPTPDDPYEVTRARELNQLLGPKASGRAFDFVLDLHNTTA
NMGTCLIAKSSHEVFAMHLCRHLQLQYPELSCQVFLYQRSGEESYNLDSVAKNGLGLELG
PQPQGVLRADIFSRMRTLVATVLDFIELFNQGTAFPAFEMEAYRPVGVVDFPRTEAGNLA
GTVHPQLQDRDFQPLQPGAPIFQMFSGEDLLYEGESTVYPVFINEAAYYEKGVAFVQTEK
FTFTVPAMPALTPAPSPAS
NT seq 960 nt   +upstreamnt  +downstreamnt
atgtgctcactgcctgtgccccgggagcccctgcgtcgcgtggctgtgaccgggggcacg
catggcaacgagatgtcgggcgtctacctggcccggcactggctgcatgcccccgcagag
ctgcagagagccagcttctccgctgtgcctgtgctggccaacccggcagccacatccggc
tgccgccgctacgtggaccatgacctcaaccgcaccttcaccagcagcttcctcaattcc
aggcccaccccggacgacccatacgaggtgacaagagcccgagagctgaaccagctgctg
gggcccaaggcctcgggccgggcctttgactttgtccttgacctgcacaacaccacggcc
aacatgggcacctgcttaatcgcgaagtcctcccacgaagtctttgccatgcacctgtgc
cgccatctgcagctgcagtaccccgagctgtcctgccaggtcttcctgtaccagcggtct
ggggaggagagctacaacctggactctgtggccaaaaatggattgggtctggagctgggc
ccccagccacagggtgtgctgcgggctgacattttctcaaggatgaggaccctggtggcc
acagttctggacttcatcgaactcttcaaccagggtacggcctttcctgcctttgagatg
gaagcctatagacccgtgggcgtcgtggacttcccccgcaccgaggccgggaacctggca
ggcactgtccatcctcagctgcaggaccgagacttccagccactgcagcctggtgctccc
atcttccagatgttcagtggggaggacctgctctatgagggagagtccacggtgtacccc
gtgttcattaacgaggctgcctactatgagaagggtgttgcctttgtccagactgagaag
ttcacattcaccgtgcctgccatgcccgcgctgacccctgccccgagcccagcttcctaa

DBGET integrated database retrieval system