KEGG   Pan troglodytes (chimpanzee): 451435Help
Entry
451435            CDS       T01005                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: olfactory guanylyl cyclase GC-D-like
  KO
K12321  guanylate cyclase 2D/E [EC:4.6.1.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00230  Purine metabolism
ptr01100  Metabolic pathways
ptr04740  Olfactory transduction
ptr04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    451435
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    451435
   04740 Olfactory transduction
    451435
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    451435
Enzymes [BR:ptr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     451435
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   451435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase HNOBA
Motif
Other DBs
NCBI-GeneID: 451435
NCBI-ProteinID: XP_016777873
Position
11
AA seq 838 aa AA seqDB search
MEGVGLWPPQYGSPEAQRKPGLQALKSICGAVDALGGAGGLGDDHPAEPCAWAEGLVDGR
LVFLPYDMLLFSLSYCNCSYLSLGTGGPLQEAYDAVLTISQESGPIDKAFAAALPDGEVA
AHLEPEQVGVLLVQTPNALSGGPGQGCTRSGLSELGSPGDARFLVLRRQQCLEVVTDVDA
DDASGPGVPDPSPRQRACVETVFSALLAQLALTVRQKWKRGEESLGIQQLQLVWGPHRIL
LTAQELTFIHPPLNRQRLHVDGEWRSVADGGSLRSVAQGSAKSLPAPQEPTNVALYQGYW
VWLKKCEVGSDPELRPSCLSLPRKMWELQCENVATCLGIFVXSLGNLLRKEVLHLDWTFK
ASLLLDLIQGVRYLHHHHFPPGCLKFQNCVVDRCFVLKVTDHGYAEPLDTXQDPQPWPAP
EELLWTAPELLLGPGRPGWHTLTGDIFSTGIILQEVLTWGPLYCSSGLPARPMVLVAEII
RRVASPPPLCRPLVTPDHGPPECIXLMKKCWDEAPEDRPSMDQIYSQFKSINQGKRTSVA
DSMLWLLEKYSQNLEDLIQEQTEELELKREKTERLLCQMIPPSVAEARKMGATVEPGYFD
QVTIYFSDIVGFTIISALSEPIEVVGLLNDLYMLFDAVLGSHDLYKVETTGDAYMVVWGL
PQCNGSQHAAEINNMALDILGSVGDFWKRHAPNVPICIRAGLHSGPCAAGVVGLTMPWYC
LFGYTVNTASQMESTGLPYRIHVSRSTVQILLSLDESYQIDIRGQTELQAREFCGKGIKE
TYWLXGKAGFPRPLPAPVDIRPGDPXXDFINQEIRADFAKARQDTAGTQSSGKTLARP
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atggagggggtgggcttgtggcccccacagtacggatccccagaggctcagcggaagcca
gggctgcaggccctgaagtccatttgtggtgctgtggatgcactcggcggtgctgggggg
cttggagatgaccaccctgctgagccgtgtgcctgggccgagggcctggtggatgggaga
ttagtcttcctgccctatgacatgctgctcttctccctgtcctactgcaactgctcctac
ctgtctctcggcactggtggacccctgcaggaggcctatgatgcagtgctcaccatcagc
caggagtctggccccatagacaaggcctttgctgctgccctgcccgatggagaggtggct
gcccacctggagccagagcaggtaggtgtgctcctcgtgcagaccccaaatgccttgagt
gggggtccggggcaggggtgcacgcgctcaggactcagtgaacttgggtctcctggggat
gcccgcttcttggtgttaagaagacagcagtgcctggaggtggtgacggatgtggatgct
gatgatgcatcaggcccaggggttccagacccgagcccgaggcagagggcctgtgtggag
acagtgttcagtgccctcctggcccagctggcactgacagtgagacagaaatggaaacgg
ggagaggaaagtttgggcatccagcagctgcagctggtgtggggcccccaccggatcctg
ctgacagcccaggagctcaccttcatccatccacccctgaacagacagaggctgcatgtg
gatggtgaatggagaagtgtggcggatggtgggagcctgaggtcagtggcccaggggtca
gcaaagagtctgccagccccccaggaacccaccaatgtggccctgtaccaaggatactgg
gtgtggctgaagaagtgtgaagtgggctcagaccctgagctgcgcccaagctgcctcagc
ctcccgaggaagatgtgggagctgcagtgtgagaacgttgccacctgcctgggcattttc
gtgnnatctctggggaacctgctgcggaaagaggtcctgcacctagactggaccttcaag
gcctccctgctgctggatttgattcagggcgtgaggtatctgcaccaccaccatttccct
cctggctgcctcaagttccaaaactgtgtggtggacagatgctttgtgctcaaggtcact
gaccatggttatgcagagcccctggacacttagcaggatccccaaccctggccagccccg
gaagagctgctatggacagctcctgagctgctgctggggcctgggcgccctgggtggcac
accctcacaggggacatcttcagcactggcatcatcctgcaggaggtgctgacttggggc
ccactctactgctcctcgggactcccagcccgccccatggtgttggttgccgaaatcatc
aggagggtggcatctccccctcctctgtgccggccgctggtgacccctgatcacgggccg
cctgagtgcattnggctgatgaagaagtgctgggacgaggctccagaggacagacctagc
atggaccagatctacagccagttcaaaagcatcaaccaaggcaagaggaccagtgttgct
gactccatgctgtggttgctggagaaatattcccagaacctggaggacctgattcaggag
cagactgaggaactggagctgaagagagagaagacagaaaggctgctctgtcagatgatt
cccccgtctgtggctgaagctcggaaaatgggggcaactgtggaaccagggtattttgac
caggttaccatatacttcagtgacattgtgggtttcaccatcatctcagccctgagtgaa
cccattgaggtggtgggcttgctcaacgatctctacatgctgtttgatgctgttctgggc
agccatgacctgtataaggtggagaccactggggacgcctacatggtggtgtgggggctg
cctcagtgcaatgggagtcagcatgcggccgagatcaataacatggctctggatatcctt
ggctctgtgggtgacttctggaagaggcatgcacccaacgtgcccatttgcatcagggct
ggcctgcattcagggccctgtgcagcaggggtcgtgggtctcacgatgccttggtattgc
ctctttgggtacactgtcaacacggcttcccagatggagtccacagggctgccatacaga
attcatgtcagccgaagcactgtccagatactgctcagccttgatgaaagctaccaaatt
gatatcagaggtcagactgagctgcaggcgagagaattttgtgggaagggcatcaaagag
acctactggctgngggggaaggcaggcttccccaggcccctccccgcacctgtggacatc
agacctggagacccttagtaagacttcataaaccaagaaatcagggcagactttgccaaa
gcccgtcaggacacggcagggacccagagctccgggaagaccttggccaggccctga

DBGET integrated database retrieval system