KEGG   Pan troglodytes (chimpanzee): 451739Help
Entry
451739            CDS       T01005                                 

Gene name
WNK1
Definition
(RefSeq) serine/threonine-protein kinase WNK1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    451739 (WNK1)
   01009 Protein phosphatases and associated proteins [BR:ptr01009]
    451739 (WNK1)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     451739 (WNK1)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: Other
  Wnk family
   451739 (WNK1)
Protein phosphatases and associated proteins [BR:ptr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     451739 (WNK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 451739
NCBI-ProteinID: NP_001171977
Ensembl: ENSPTRG00000004513
VGNC: 13495
UniProt: K7BE89
Position
12
AA seq 2382 aa AA seqDB search
MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHT
MDKDSRGAAATTTTTEHRFFRRSVICDSNATALELPGLPLSLPQPSIPAAVPQSAPPEPH
REETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPP
ARSGSGGGSAKEPQEERSQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLD
TETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLV
TELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGP
TGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEY
PYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQ
EETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEM
VESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQLVREEQEKKRQEESSLKQQVEQSSASQ
TGIKQLPSASTGIPTASTTSASVSTQVEPEEPEADQHQQLQYQQPSISVLSDGTVDSGQG
SSVFTESRVSSQQTVSYGSQHEQAHSTGTVPGHIPSTVQAQSQPHGVYPPSSVAQGQSQG
QPSSSSLTGVSSSQPIQHPQQQQGIQQTAPPQQTVQYSLSQTSTSSEATTAQPVSQPQAP
QVLPQVSAGKQLPVSQPVPTIQGEPQIPVATQPSVVPVHSGAHFLPVGQPLPTPLLPQYP
VSQIPISTPHVSTAQTGFSSLPITMAAGITQPLLTLASSATTAAIPGVSTVVPSQLPTLL
QPVTQLPSQVHPQLLQPAVQSMGIPANLGQAAEVPLSSGDVLYQGFPPRLPPQYPGDSNI
APSSNVASVCIHSTVLSPPMPTEVLATHGYFPTVVQPYVESNLLVPMGGVGGQVQVSQPG
GSLAQAPTTSSQQAVLESTQGVSQVAPAEPVAVAQPQPTQPTTLASSVDSAHSDVASGMS
DGNENVPSSSGRHEGRTTKRHYRKSVRSRSRHEKTSRPKLRILNVSNKGDRVVECQLETH
NRKMVTFKFDLDGDNPEEIATIMVNNDFILAIERESFVDQVREIIEKADEMLSEDVSVEP
EGDQGLESLQGKDDYGFSGSQKLEGEFKQPTPASSMPQQIGIPTSSLTQVVHSAGRRFIV
SPVPEGRLRESKVFPSEITDTVAASTAQSPGMNLSHSASSLSLQQAFSELRRAQMTEGPN
TAPPNFSHTGPTFPVVPPFLSSIAGVPTTAAATAPVPATSSPPNDISTSVIQSEVTGPTE
EGIAGVASSTGVVTSGGLPIPPVSESPVLSSVVSSITVPAVVSISTTSPSLQVPTSTSES
VVSSTALYPSVTVSATSASAGGSTATPGPKPPAVVSQQAAGSTTVGATLTSVSTTTSFPS
TASQLSIQLSSSTSAPTLAETVVVSAHSLDKTSHSSTTGLAFSLSAPSSSSSPGAGVSSS
ISQPGGLHPLVIPSVIASTPILPQAAGPTSTPLLPQVPSIPPLVQPVANVPAVQQTLIHS
QPQPALLPNQPHTHCPEIDSDTQPKAPGIDDIKTLEEKLRSLFSEHSSSGAQHASVSLET
SLVIESTVTPGIPTTAVAPSKLLTSTTSTCLPPTNLPLGTVALPVTPVVTPGQVSTPVST
TTSGVKPGTAPSKPPLTKAPVLPVGTELPAGTLPSEQLPPFPGPSLTQSQQPLEDLDAQL
RRTLSPEIITVTSAVGPVSVVAPAAITEAGAQPQKDVSQVKEGPVLATSSGAGVFKMGRF
QVSVAADDAQKEGKNKSEDAKSVHFESSTSESSVLSSSSPESTLVKPEPNGITIPGISSD
VPESAHKTTASEAKSDTGQPTKVGRFQVTTTANKVGRFSVSKTEDKITDTKKEGPVASPP
FMDLEQAVLPAVIPKKEKPELSEPSHLNGPSSDPEAAFLSRDVDDGSGSPHSPHQLSSKS
LPSQNLSQSLSNSFNSSYMSSDNESDIEDEDLKLELRRLRDKHLKEIQDLQSRQKHEIES
LYTKLGKVPPAVIIPPAAPLSGRRRRPTKSKGSKSSRSSSLGNKSPQLSGNLSGQSAASV
LHPQQTLHPPGNIPESGQNQLLQPLKPSPSSDNLYSAFTSDGAISVPSLSAPGQGTSSTN
TVGATVNSQAAQAQPPAMTSSRKGTFTDDLHKLVDNWARDAMNLSGRRGSKGHMNYEGPG
MARKFSAPGQLCISMTSNLGGSAPISAASATSLGHFTKSMCPPQQYGFPATPFGTQWSGT
GGPAPQPLGQFQPVGTASLQNFNISNLQKSISNPPGSNLRTT
NT seq 7149 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcggcgccgcagagaagcagagcagcactcccggttccctgttcctctcgccg
ccggctcctgcccccaagaatggctccagctccgattcctccgtgggggagaaactggga
gccgcggccgccgacgctgtgaccggcaggaccgaggagtacaggcgccgccgccacact
atggacaaggacagccgtggggcggccgcgaccactaccaccactgagcaccgcttcttc
cgccggagtgtcatctgcgactccaatgccactgcactggagcttcccggccttcctctc
tccctcccccagcccagcatccccgcggctgtcccgcagagtgctccgccggagccccac
cgggaagagaccgtgaccgccaccgccacttcccaggtagcccagcagcctccagccgct
gccgcccctggggaacaggccgtcgcgggccctgccccctcgaccgtccccagcagtacc
agcaaagaccgcccagtgtcccagcctagccttgtggggagcaaagaggagccgccgccg
gcgagaagtggcagcggcggcggcagcgccaaggagccacaggaggaacggagccagcag
caggatgatatcgaagagctggagaccaaggccgtgggaatgtctaacgatggccgcttt
ctcaagtttgacatcgaaatcggcagaggctcctttaagacggtctacaaaggtctggac
actgaaaccaccgtggaagtcgcctggtgtgaactgcaggatcgaaaattaacaaagtct
gagaggcagagatttaaagaagaagctgaaatgttaaaaggtcttcagcatcccaatatt
gttagattttatgattcctgggaatccacagtaaaaggaaagaagtgcattgttttggtg
actgaacttatgacgtctggaacacttaaaacgtatctgaaaaggtttaaagtgatgaag
atcaaagttctaagaagctggtgccgtcagatccttaaaggtcttcagtttcttcatact
cgaactccacctatcattcaccgcgatcttaaatgtgacaacatctttatcaccggccct
actggctcagtcaagattggagacctcggtctggcaaccctgaagcgggcttcttttgcc
aagagtgtgataggtaccccagagttcatggcccctgagatgtatgaggagaaatatgat
gaatccgttgacgtttatgcttttgggatgtgcatgcttgagatggctacatctgaatat
ccttactcggagtgccaaaatgctgcgcagatctaccgtcgcgtgaccagtggggtgaag
ccagccagttttgacaaagtagcaattcctgaagtgaaggaaattattgaaggatgcata
cgacaaaacaaagatgaaagatattccatcaaagaccttttgaaccatgccttcttccaa
gaggaaacaggagtacgggtagaattagcagaagaagacgatggagaaaaaatagccata
aaattatggctacgtattgaagatattaagaaattaaagggaaaatacaaagataatgaa
gctattgagttttcttttgatttagagagagatgtcccagaagatgttgcacaagaaatg
gtagagtctgggtatgtctgtgaaggtgatcacaagaccatggctaaagctatcaaagac
agagtatcattaattaagaggaaacgagagcagcggcagttggtacgggaggagcaagaa
aaaaaaaggcaggaagagagcagtctcaaacagcaggtagaacaatccagtgcttcccag
acaggaatcaagcagctcccttctgctagcaccggcatacctactgcttctaccacttca
gcttcagtttctacacaagtagaacctgaagaacctgaggcagatcaacatcaacaacta
cagtaccagcaacccagtatatctgtgttatctgatgggacggttgacagtggtcaggga
tcctctgtcttcacagaatctcgagtgagcagccaacagacagtttcatatggttcccaa
catgaacaggcacattctacaggcacagtcccagggcatataccttctactgtccaagca
caatctcagccccatggggtatatccaccctcaagtgtggcacaggggcagagccagggt
cagccatcctcaagtagcttaacaggggtttcatcttcccaacccatacaacatcctcag
cagcagcagggaatacagcagacagcccctcctcaacagacagtgcagtattcactttca
cagacatcaacctccagtgaggccactactgcacagccagtgagtcaacctcaagctcca
caagtcttgcctcaagtatcagctggaaaacagcttccagtttcccagccagtaccaact
atccaaggcgaacctcagatcccagttgcgacacaaccctcggttgttccagtccactct
ggtgctcatttccttccagtgggacagccgctccctactcccttgctccctcagtaccct
gtctctcaaattcccatatcaactcctcatgtgtctacggctcagacaggtttctcatcc
cttcccatcacaatggcagctggcattactcagcctctgctcacgttggcttcatctgct
acaacagctgcgatcccgggggtatcaactgtggttcctagtcagcttccaacccttctg
cagcctgtgactcagctgccaagtcaggttcacccacagctcctacaaccagcagttcag
tccatgggaataccagctaaccttggacaagctgctgaggttccactttcctctggagat
gttctgtaccagggcttcccacctcgactgccaccacagtacccaggagattcaaatatt
gctccctcttccaacgtggcttctgtttgcatccattctacagtcctatcccctcccatg
ccgacagaagtactggctacacatgggtactttcccacagtggtgcagccttatgtggaa
tcaaatcttttagttcctatgggtggtgtaggaggacaggttcaagtgtcccagccagga
gggagtttagcacaagcccccactacatcctcccagcaagcagttttggagagtactcag
ggagtctctcaggttgctcctgcagagccagttgcagtagcacagccacaacctacccag
ccgaccactttggcttcctctgtagacagtgcacattcagatgttgcttcaggtatgagt
gatggcaatgagaatgtcccatcttccagtggaaggcatgaaggaagaactacaaaacgg
cattaccgaaaatctgtaaggagtcgctctcgacatgaaaaaacttcacgcccaaaatta
agaattttgaatgtttcaaataaaggagaccgagtagtagaatgtcaattagagactcat
aataggaaaatggttacattcaaatttgacctagatggtgacaaccccgaggagatagca
acaattatggtgaacaatgactttattctagcaatagagagagagtcatttgtggatcaa
gtgcgagaaattattgaaaaagctgatgaaatgctcagtgaggatgtcagtgtggaacca
gagggtgatcagggattggagagtctacaaggaaaggatgactatggcttttcaggttct
cagaaattggaaggagagttcaaacaaccaactcctgcgtcttccatgccacagcaaata
ggcattcctaccagttctttaactcaagttgttcattctgcgggaaggcggtttatagtg
agtcctgtgccagaaggccgattacgagaatcaaaagttttccccagtgaaataacagat
acagttgctgcctctacagctcagagccctggaatgaacttgtctcactctgcatcatcc
cttagtctacaacaggccttttctgaacttagacgtgcccaaatgacagaaggacccaat
acagcacctccaaactttagtcatacaggaccaacatttccagtagtacctcctttctta
agtagcattgctggagtcccaaccacagcagcagccacagcaccagtccctgcaacaagc
agccctcctaatgacatttccacatcagtaattcagtctgaggttacagggcccactgaa
gaggggattgctggagttgcctccagcacaggtgtggtaacttcaggtggtctccccata
ccacctgtgtctgaatcaccagtactttccagcgtagtttcaagtatcacagtacctgca
gttgtctcaatatctactacatccccgtcacttcaagtccccacatccacatctgagagc
gttgtttctagtacagcactgtatccttcagtaacagtttcagcaacttcagcctctgca
gggggcagtactgctaccccaggtcctaagcctccagctgtagtatctcagcaggcagca
ggcagcactactgtgggagccacattaacatcagtttctaccaccacttcattcccaagc
acagcttcacagctgtccattcagcttagcagcagtacttctgctcctactttagctgaa
accgtggtagttagcgcacactcactagataagacatctcatagcagtacaactggattg
gctttctccctctctgcaccatcttcctcttcctctcctggagcaggagtgtctagttct
atttctcagcctggtgggctgcatcctttggtcattccatcagtgatagcttctactcct
attcttccccaagcagcaggtcctacttctacacctttattaccccaagtacctagtatc
ccacccttggtacagcctgttgccaatgtgcctgctgtacagcagacactaattcatagt
cagcctcaaccagctttgcttcccaaccagccccatactcattgtcctgaaatagattct
gatacacaacccaaagctcctggaattgatgacataaagactctagaagaaaagctgcgg
tctctcttcagtgaacacagctcctctggagctcagcatgcctctgtctcactggagacc
tcactagtcatagagagcactgtcacaccaggcatcccaactactgctgttgcaccaagc
aaactcctgacttctaccacaagtacttgcttaccaccaaccaatttaccactaggaaca
gttgctttgccagttacaccagtggtcacacctgggcaagtttctaccccagtcagcact
actacatcaggagtgaaacctggaactgctccctccaagccacctctaactaaggctccg
gtgctgccagtgggtactgaacttccagcaggtactctacccagcgagcagctgccacct
tttccaggaccttctctaacccagtcccagcaacctctagaggatcttgatgctcaattg
agaagaacacttagtccagagattatcacagtgacttctgcggttggtcctgtgtccgtg
gtggctccagcagcaattacagaagcaggagcacagcctcagaaggatgtttctcaagtc
aaagaaggccctgtcctagcaactagttcaggagctggtgtttttaagatgggacgattt
caggtttcagttgcagcagacgatgcccagaaagagggtaaaaataagtcagaagatgca
aagtctgttcattttgaatccagcacttcagagtcctcagtgctatcaagtagtagtcca
gagagtaccttggtgaaaccagagccgaatgggataaccatccctggtatctcttcagat
gtgccagagagtgcccacaaaactactgcctcagaggcaaagtcagacactgggcagcct
accaaggttggacgttttcaggtgacaactacagcaaacaaagtgggtcgtttctctgta
tcaaaaactgaggacaagatcactgacacaaagaaagaaggaccagtggcatctcctcct
tttatggatttggaacaagctgttcttcctgctgtgataccaaagaaagaaaagcctgaa
ctgtcagagccttcacatctaaatgggccgtcttctgacccggaggccgcttttttaagt
agggatgtggatgatggttccggtagtccacactccccccatcagctgagctcaaagagc
cttcctagccagaatctaagtcaaagccttagtaattcatttaactcctcttacatgagt
agcgacaatgagtcagatatcgaagatgaagacttaaagttagagctgcgacgactacga
gataaacatctcaaagagattcaggacctgcagagtcgccagaagcatgaaattgaatct
ttgtataccaaactgggcaaggtgccccctgctgttattattcccccagctgctcccctt
tcagggagaagacgacgacccactaaaagcaaaggcagcaaatctagtcgaagcagttcc
ttggggaataaaagcccccagctttcaggtaacctgtctggtcagagtgcagcttcagtc
ttgcacccccagcagaccctccaccctcctggcaacatcccagagtccgggcagaatcag
ctgttacagccccttaagccatctccctccagtgacaacctctattcagccttcaccagt
gatggtgccatttcagtaccaagcctttctgctccaggtcaagggaccagcagcacaaac
actgttggggcaacagtgaacagccaagccgcccaagctcagcctcctgccatgacgtcc
agcaggaagggcacattcacagatgacttgcacaagttggtagacaattgggcccgagat
gccatgaatctctcaggcaggagaggaagcaaagggcacatgaattatgagggccctgga
atggcaaggaagttctctgcacctgggcaactgtgcatctccatgacctcgaacctgggt
ggctctgcccccatctctgcagcatcagctacctctctaggtcacttcaccaagtctatg
tgccccccacagcagtatggctttccagctaccccatttggcactcaatggagtgggacg
ggtggcccagcaccacagccacttggccagttccaacctgtgggaactgcctccttgcag
aatttcaacatcagcaatttgcagaaatccatcagcaaccccccaggctccaacctgcgg
accacttag

DBGET integrated database retrieval system