KEGG   Pan troglodytes (chimpanzee): 451866Help
Entry
451866            CDS       T01005                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase type 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00230  Purine metabolism
ptr01522  Endocrine resistance
ptr04015  Rap1 signaling pathway
ptr04022  cGMP-PKG signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04114  Oocyte meiosis
ptr04211  Longevity regulating pathway
ptr04213  Longevity regulating pathway - multiple species
ptr04261  Adrenergic signaling in cardiomyocytes
ptr04270  Vascular smooth muscle contraction
ptr04371  Apelin signaling pathway
ptr04540  Gap junction
ptr04611  Platelet activation
ptr04713  Circadian entrainment
ptr04714  Thermogenesis
ptr04723  Retrograde endocannabinoid signaling
ptr04724  Glutamatergic synapse
ptr04725  Cholinergic synapse
ptr04727  GABAergic synapse
ptr04742  Taste transduction
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04911  Insulin secretion
ptr04912  GnRH signaling pathway
ptr04913  Ovarian steroidogenesis
ptr04914  Progesterone-mediated oocyte maturation
ptr04915  Estrogen signaling pathway
ptr04916  Melanogenesis
ptr04918  Thyroid hormone synthesis
ptr04921  Oxytocin signaling pathway
ptr04923  Regulation of lipolysis in adipocytes
ptr04924  Renin secretion
ptr04925  Aldosterone synthesis and secretion
ptr04926  Relaxin signaling pathway
ptr04927  Cortisol synthesis and secretion
ptr04928  Parathyroid hormone synthesis, secretion and action
ptr04934  Cushing's syndrome
ptr04961  Endocrine and other factor-regulated calcium reabsorption
ptr04962  Vasopressin-regulated water reabsorption
ptr04970  Salivary secretion
ptr04971  Gastric acid secretion
ptr04972  Pancreatic secretion
ptr04976  Bile secretion
ptr05032  Morphine addiction
ptr05163  Human cytomegalovirus infection
ptr05166  HTLV-I infection
ptr05200  Pathways in cancer
ptr05414  Dilated cardiomyopathy (DCM)
Module
ptr_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    451866 (ADCY6)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    451866 (ADCY6)
   04371 Apelin signaling pathway
    451866 (ADCY6)
   04072 Phospholipase D signaling pathway
    451866 (ADCY6)
   04024 cAMP signaling pathway
    451866 (ADCY6)
   04022 cGMP - PKG signaling pathway
    451866 (ADCY6)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    451866 (ADCY6)
  Cellular community - eukaryotes
   04540 Gap junction
    451866 (ADCY6)
 Organismal Systems
  Immune system
   04611 Platelet activation
    451866 (ADCY6)
   04062 Chemokine signaling pathway
    451866 (ADCY6)
  Endocrine system
   04911 Insulin secretion
    451866 (ADCY6)
   04923 Regulation of lipolysis in adipocyte
    451866 (ADCY6)
   04912 GnRH signaling pathway
    451866 (ADCY6)
   04913 Ovarian Steroidogenesis
    451866 (ADCY6)
   04915 Estrogen signaling pathway
    451866 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    451866 (ADCY6)
   04921 Oxytocin signaling pathway
    451866 (ADCY6)
   04926 Relaxin signaling pathway
    451866 (ADCY6)
   04918 Thyroid hormone synthesis
    451866 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    451866 (ADCY6)
   04916 Melanogenesis
    451866 (ADCY6)
   04924 Renin secretion
    451866 (ADCY6)
   04925 Aldosterone synthesis and secretion
    451866 (ADCY6)
   04927 Cortisol synthesis and secretion
    451866 (ADCY6)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    451866 (ADCY6)
   04270 Vascular smooth muscle contraction
    451866 (ADCY6)
  Digestive system
   04970 Salivary secretion
    451866 (ADCY6)
   04971 Gastric acid secretion
    451866 (ADCY6)
   04972 Pancreatic secretion
    451866 (ADCY6)
   04976 Bile secretion
    451866 (ADCY6)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    451866 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    451866 (ADCY6)
  Nervous system
   04724 Glutamatergic synapse
    451866 (ADCY6)
   04727 GABAergic synapse
    451866 (ADCY6)
   04725 Cholinergic synapse
    451866 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    451866 (ADCY6)
  Sensory system
   04742 Taste transduction
    451866 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    451866 (ADCY6)
  Aging
   04211 Longevity regulating pathway - mammal
    451866 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    451866 (ADCY6)
  Environmental adaptation
   04713 Circadian entrainment
    451866 (ADCY6)
   04714 Thermogenesis
    451866 (ADCY6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    451866 (ADCY6)
  Substance dependence
   05032 Morphine addiction
    451866 (ADCY6)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    451866 (ADCY6)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    451866 (ADCY6)
  Infectious diseases
   05166 HTLV-I infection
    451866 (ADCY6)
   05163 Human cytomegalovirus infection
    451866 (ADCY6)
  Drug resistance
   01522 Endocrine resistance
    451866 (ADCY6)
Enzymes [BR:ptr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     451866 (ADCY6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA Shisa CstA
Motif
Other DBs
NCBI-GeneID: 451866
NCBI-ProteinID: XP_016779005
VGNC: 12756
UniProt: K7DS66
Position
12
AA seq 1168 aa AA seqDB search
MSWFSGLLVPKVDERKTAWGERNGQKRSRRRGTRAGGFCTPRYMSCLRDAEPPSPTPAGP
PRCPWQDDAFIRRGGPGKGKELGLRAVALGFEDTEVTTTAGGTAEVAPDAVPRSGRSCWR
RLVQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTVVLLAFHAAPARPHPAY
VALLACAAALFVGLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAADPRSPSAGLW
CPVFFVYIAYTLLPIRMRAAVLSGLGLSTLHLILAWQLNRGDAFLWKQLGANVLLFLCTN
VIGICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINT
KKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHC
LRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRV
HCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNA
YLKEQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFR
QMGIDDSSKDNRGTQDALNPEDEVDEFLSRAIDARSIDQLRKDHVRRFLLTFQREDLEKK
YSRKVDPRFGAYVACALLVFCFICFIQLLIFPHSTLMLGIYASIFLLLLIAVLICAVYSC
GSLFPKALQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPIRTCAARMLNLT
PADITACHLQQLNYSLGLDAPLCEGTMPTCSFPEYFIGNMLLSLLASSVFLHISSIGKLA
MIFVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPV
ILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHF
LARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIIS
EERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNN
FQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKG
YQLECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atgtcatggtttagtggcctcctggtccctaaagtggatgaacggaaaacagcctggggt
gaacgcaatgggcagaagcgttcgcggcgccgtggcactcgggcaggtggcttctgcacg
ccccgctatatgagctgcctccgggatgcagagccacccagccccacccctgcgggcccc
cctcggtgcccctggcaggatgacgccttcatccggaggggcggcccaggcaagggcaag
gagctggggctgcgggcagtggccctgggcttcgaggataccgaggtgacaacgacagcg
ggcgggacggctgaggtggcgcccgacgcggtgcccaggagtgggcgatcctgctggcgc
cgtctggtgcaggtgttccagtcgaagcagttccgttcggccaagctggagcgcctgtac
cagcggtacttcttccagatgaaccagagcagcctgacgctgctgatggcggtgctggtg
ctgctcacagtggtgctgctggctttccacgccgcacccgcccgccctcaccctgcctat
gtggcactgttggcctgtgccgccgccctgttcgtggggctcatggtggtgtgtaaccgg
catagcttccgccaggactccatgtgggtggtgagctacgtggtgctgggcatcctggcg
gcagtgcaggtcgggggcgctctcgcagcagacccgcgcagcccctctgcgggcctctgg
tgccctgtgttctttgtctacatcgcctacacgctcctccccatccgcatgcgggctgcc
gtcctcagcggcctgggcctctccaccttgcatttgatcttggcctggcaacttaaccgt
ggtgatgccttcctctggaagcagctcggtgccaatgtgctgctgttcctctgcaccaac
gtcattggcatctgcacacactatccagcagaggtgtctcagcgccaggcctttcaggag
acccgcggttacatccaggcccggctccacctgcagcatgagaatcggcagcaggagcgg
ctgctgctgtcggtattgccccagcacgttgccatggagatgaaagaagacatcaacaca
aaaaaagaagacatgatgttccacaagatctacatacagaagcatgacaatgtcagcatc
ctgtttgcagacattgagggcttcaccagcctggcatcccagtgcaccgcgcaggagctg
gtcatgaccctgaatgagctctttgcccggtttgacaagctggctgcggagaatcactgc
ctgaggatcaagatcttgggggactgttactactgtgtgtcagggctgccggaggcccgg
gccgaccatgcccactgctgtgtggagatgggggtagacatgatcgaggccatctcgctg
gtacgtgaggtgacaggtgtgaatgtgaacatgcgcgtgggcatccacagcgggcgcgtg
cactgcggcgtccttggcttgcggaaatggcagttcgatgtgtggtccaatgatgtgacc
ctggccaaccacatggaggcaggaggccgggctggccgcatccacatcactcgggcaaca
ctgcagtacctgaacggggactacgaggtggagccaggccgtggtggcgagcgcaacgcg
tacctcaaggagcagcacattgagactttcctcatcctgggcgccagccagaaacggaaa
gaggagaaggccatgctggccaagctgcagcggactcgggccaactccatggaagggctg
atgccgcgctgggtgcctgatcgtgccttctcccggaccaaggactccaaggccttccgc
cagatgggcattgatgattccagcaaagacaaccggggcacccaagatgccctgaaccct
gaggatgaggtggatgagttcctgagccgtgccatcgatgcccgcagcattgatcagctg
cggaaggaccatgtgcgccggtttctgctcaccttccagagagaggatcttgagaagaag
tactcccggaaggtggatccccgcttcggagcctacgttgcctgtgccctgttggtcttc
tgcttcatctgcttcatccagcttctcatcttcccacactccaccctgatgcttgggatc
tatgccagcatcttcctgctgctgctaatcgccgtgctgatctgtgccgtgtactcctgt
ggttctctgttccctaaggccctgcaacgtctgtcccgcagcattgtccgctcacgggca
catagcaccgcagttggcatcttttccgtcctgcttgtgtttacttctgccattgccaac
atgttcacctgtaaccacacccccatacggacctgtgcagcccggatgctgaatttaaca
cctgctgacatcactgcctgccacctgcagcagctcaattactctctgggcctggatgct
cccctgtgtgagggcaccatgcccacctgcagctttcctgagtacttcatcgggaacatg
ctgctgagtctcttggccagctctgtcttcctacacatcagcagcatcgggaagttggcc
atgatctttgtcttggggctcatctatttggtgctgcttctgctgggtcccccagccacc
atctttgacaactatgacctactgcttggcgtccatggcttggcttcttccaatgagacc
tttgatgggctggactgtccagctgcagggagggtggccctcaaatatatgacccctgtg
attctgctggtgtttgcgctggcgctgtatctgcatgctcagcaggtggagtcgactgcc
cgcctagacttcctctggaaactacaggcaacaggggagaaggaggagatggaggagcta
caggcatacaaccggaggctgctgcataacattctgcccaaggacgtggcggcccacttc
ctggcccgggagcgccgcaatgatgaactctactatcagtcgtgtgagtgtgtggctgtt
atgtttgcctccattgccaacttctctgagttctatgtggagctagaggcaaacaatgag
ggtgtcgagtgcctgcggctgctcaacgagatcatcgctgactttgatgagattatcagc
gaggagcggttccggcagctggaaaagatcaagacgattggtagcacctacatggctgcc
tcagggctgaacgccagcacctacgatcaggtgggccgctcccacatcactgccctggct
gactacgccatgcggctcatggagcagatgaagcacatcaatgagcactccttcaacaat
ttccagatgaagattgggctgaacatgggcccagtcgtggcaggtgtcatcggggctcgg
aagccacagtatgacatctgggggaacacagtgaatgtctctagtcgtatggacagcacg
ggggtccccgaccgaatccaggtgaccacggacctgtaccaggttctagctgccaagggc
taccagctggagtgtcgaggggtggtcaaggtgaagggcaagggggagatgaccacctac
ttcctcaatgggggccccagcagttaa

DBGET integrated database retrieval system