KEGG   Pan troglodytes (chimpanzee): 451888
Entry
451888            CDS       T01005                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X2
  KO
K04829  acid-sensing ion channel 1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    451888 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ptr04040]
    451888 (ASIC1)
Ion channels [BR:ptr04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   451888 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 451888
NCBI-ProteinID: XP_001155207
Ensembl: ENSPTRG00000004923
VGNC: 4938
UniProt: K7B9U4
Position
12
AA seq 528 aa
MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCV
CTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN
RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCS
AEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETS
FEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDSDLD
FFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEY
CVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETI
EQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKQAKRSSA
DKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1587 nt   +upstreamnt  +downstreamnt
atggaactgaaggccgaggaggaggaggtgggtggcgtccagccggtgagcatccaggcc
ttcgccagcagctccacgctgcacggcctggcccacatcttctcctacgagcggctgtct
ctgaagcgggcactgtgggccctgtgcttcctgggctcgctggctgtgctgctgtgtgtg
tgcaccgagcgtgtgcagtactacttccactaccaccatgtcaccaagctcgacgaggtg
gctgcctctcagcttaccttccctgctgtcacgctgtgcaacctcaacgagttccgcttt
agccaagtctccaagaatgacctgtatcatgctggggagctgctggccctgctcaacaac
aggtatgagataccagacacacagatggcagatgaaaagcagctggagatactgcaggac
aaagccaacttccgcagcttcaaacccaaacccttcaacatgcgtgagttctacgaccga
gctgggcacgacattcgagacatgctgctctcctgccatttccggggggaggtctgcagc
gctgaagacttcaaggtggtcttcacacgctatggaaagtgctacacgttcaactcgggc
cgagatgggcggccgcggctgaagaccatgaagggtgggacgggcaatgggctggaaatc
atgctggacatccagcaggacgagtacctgcctgtgtggggggagactgacgagacgtcc
ttcgaagcaggcatcaaagtgcagatccatagtcaggatgaacctcctttcatcgaccag
ctgggctttggcgtggccccaggcttccagacctttgtggcctgccaggagcagcggctc
atctacctgcccccgccctggggcacctgcaaagctgttaccatggactcggatttggat
ttcttcgactcctacagcatcactgcctgccgcatcgactgtgagacgcgctacctggtg
gagaactgcaactgccgcatggtgcacatgccaggggatgccccatactgtactccagag
cagtacaaggagtgtgcagatcctgctctggacttcctggtggagaaggaccaggagtac
tgcgtgtgtgaaatgccttgcaacctgacccgctatggcaaggagctgtccatggtcaag
atccccagcaaagcctcagccaagtacctggccaagaagttcaacaaatctgagcaatac
ataggggagaacatcctggtgctggacattttctttgaagtcctcaactatgagaccatt
gaacagaagaaggcctatgagattgcagggctcctgggtgacatcgggggccagatgggg
ctgttcatcggggccagcatcctcacggtgctggagctctttgactacgcctacgaggtc
attaaacacaagctgtgccgacgaggaaaatgccagaagcaggccaaaaggagcagtgcg
gacaagggcgtggccctcagcctggacgacgtcaaaagacacaacccgtgcgagagcctc
cggggccaccctgccgggatgacatacgctgccaacatcctacctcaccatccggcccga
ggcacgttcgaggactttacctgctga

DBGET integrated database retrieval system