KEGG   Pan troglodytes (chimpanzee): 452025Help
Entry
452025            CDS       T01005                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01522  Endocrine resistance
ptr04110  Cell cycle
ptr04115  p53 signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04218  Cellular senescence
ptr04530  Tight junction
ptr04660  T cell receptor signaling pathway
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04934  Cushing's syndrome
ptr05161  Hepatitis B
ptr05162  Measles
ptr05163  Human cytomegalovirus infection
ptr05165  Human papillomavirus infection
ptr05166  HTLV-I infection
ptr05167  Kaposi's sarcoma-associated herpesvirus infection
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05212  Pancreatic cancer
ptr05214  Glioma
ptr05218  Melanoma
ptr05219  Bladder cancer
ptr05220  Chronic myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
Module
ptr_M00692  Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    452025 (CDK4)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    452025 (CDK4)
   04115 p53 signaling pathway
    452025 (CDK4)
   04218 Cellular senescence
    452025 (CDK4)
  Cellular community - eukaryotes
   04530 Tight junction
    452025 (CDK4)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    452025 (CDK4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    452025 (CDK4)
   05203 Viral carcinogenesis
    452025 (CDK4)
   05212 Pancreatic cancer
    452025 (CDK4)
   05225 Hepatocellular carcinoma
    452025 (CDK4)
   05214 Glioma
    452025 (CDK4)
   05220 Chronic myeloid leukemia
    452025 (CDK4)
   05218 Melanoma
    452025 (CDK4)
   05219 Bladder cancer
    452025 (CDK4)
   05224 Breast cancer
    452025 (CDK4)
   05222 Small cell lung cancer
    452025 (CDK4)
   05223 Non-small cell lung cancer
    452025 (CDK4)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    452025 (CDK4)
   04934 Cushing's syndrome
    452025 (CDK4)
  Infectious diseases
   05166 HTLV-I infection
    452025 (CDK4)
   05162 Measles
    452025 (CDK4)
   05161 Hepatitis B
    452025 (CDK4)
   05163 Human cytomegalovirus infection
    452025 (CDK4)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    452025 (CDK4)
   05165 Human papillomavirus infection
    452025 (CDK4)
  Drug resistance
   01522 Endocrine resistance
    452025 (CDK4)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     452025 (CDK4)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: CMGC group
  CDK family
   452025 (CDK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 452025
NCBI-ProteinID: XP_509173
Ensembl: ENSPTRG00000005147
VGNC: 8366
UniProt: H2QZZ4
Position
12
AA seq 303 aa AA seqDB search
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctacctctcgatatgagccagtggctgaaattggtgtcggtgcctatgggacagtg
tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtcccc
aatggaggaggaggtggaggaggccttcccatcagcacagttcgtgaggtggctttactg
aggcgactggaggcttttgagcatcccaatgttgtccggctgatggacgtctgtgccaca
tcccgaactgaccgggagatcaaggtaaccctggtgtttgagcatgtagaccaggaccta
aggacatatctggacaaggcacccccaccaggcttgccagccgaaaccatcaaggatctg
atgcgccagtttctaagaggcctagatttccttcatgccaattgcatcgttcaccgagat
ctgaagccagagaacattctggtgacaagtggtggaacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacccgtggttgttacactctggtac
cgagctcccgaagttcttctgcagtccacatatgcaacacctgtggacatgtggagtgtt
ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagcc
gaccagttgggcaaaatctttgacctgattgggctgcctccagaggatgactggcctcga
gatgtatccctgccccgtggagcctttccccccagagggccccgcccagtgcagtcggtg
gtacctgagatggaggagtcgggagcacagctgctgctggaaatgctgacttttaaccca
cacaagcgaatctctgcctttcgagctctgcagcactcttatctacataaggatgaaggt
aatccggagtga

DBGET integrated database retrieval system