KEGG   Pan troglodytes (chimpanzee): 452819
Entry
452819            CDS       T01005                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00230  Purine metabolism
ptr01100  Metabolic pathways
ptr01522  Endocrine resistance
ptr04015  Rap1 signaling pathway
ptr04020  Calcium signaling pathway
ptr04022  cGMP-PKG signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04114  Oocyte meiosis
ptr04211  Longevity regulating pathway
ptr04213  Longevity regulating pathway - multiple species
ptr04261  Adrenergic signaling in cardiomyocytes
ptr04270  Vascular smooth muscle contraction
ptr04371  Apelin signaling pathway
ptr04540  Gap junction
ptr04611  Platelet activation
ptr04713  Circadian entrainment
ptr04714  Thermogenesis
ptr04723  Retrograde endocannabinoid signaling
ptr04724  Glutamatergic synapse
ptr04725  Cholinergic synapse
ptr04727  GABAergic synapse
ptr04742  Taste transduction
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04911  Insulin secretion
ptr04912  GnRH signaling pathway
ptr04913  Ovarian steroidogenesis
ptr04914  Progesterone-mediated oocyte maturation
ptr04915  Estrogen signaling pathway
ptr04916  Melanogenesis
ptr04918  Thyroid hormone synthesis
ptr04921  Oxytocin signaling pathway
ptr04923  Regulation of lipolysis in adipocytes
ptr04925  Aldosterone synthesis and secretion
ptr04926  Relaxin signaling pathway
ptr04927  Cortisol synthesis and secretion
ptr04928  Parathyroid hormone synthesis, secretion and action
ptr04934  Cushing syndrome
ptr04935  Growth hormone synthesis, secretion and action
ptr04970  Salivary secretion
ptr04971  Gastric acid secretion
ptr04972  Pancreatic secretion
ptr04976  Bile secretion
ptr05032  Morphine addiction
ptr05163  Human cytomegalovirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05200  Pathways in cancer
ptr05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    452819 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    452819 (ADCY4)
   04371 Apelin signaling pathway
    452819 (ADCY4)
   04020 Calcium signaling pathway
    452819 (ADCY4)
   04072 Phospholipase D signaling pathway
    452819 (ADCY4)
   04024 cAMP signaling pathway
    452819 (ADCY4)
   04022 cGMP-PKG signaling pathway
    452819 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    452819 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    452819 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    452819 (ADCY4)
   04062 Chemokine signaling pathway
    452819 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    452819 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    452819 (ADCY4)
   04912 GnRH signaling pathway
    452819 (ADCY4)
   04913 Ovarian steroidogenesis
    452819 (ADCY4)
   04915 Estrogen signaling pathway
    452819 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    452819 (ADCY4)
   04921 Oxytocin signaling pathway
    452819 (ADCY4)
   04926 Relaxin signaling pathway
    452819 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    452819 (ADCY4)
   04918 Thyroid hormone synthesis
    452819 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    452819 (ADCY4)
   04916 Melanogenesis
    452819 (ADCY4)
   04925 Aldosterone synthesis and secretion
    452819 (ADCY4)
   04927 Cortisol synthesis and secretion
    452819 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    452819 (ADCY4)
   04270 Vascular smooth muscle contraction
    452819 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    452819 (ADCY4)
   04971 Gastric acid secretion
    452819 (ADCY4)
   04972 Pancreatic secretion
    452819 (ADCY4)
   04976 Bile secretion
    452819 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    452819 (ADCY4)
   04727 GABAergic synapse
    452819 (ADCY4)
   04725 Cholinergic synapse
    452819 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    452819 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    452819 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    452819 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    452819 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    452819 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    452819 (ADCY4)
   04714 Thermogenesis
    452819 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    452819 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    452819 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    452819 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    452819 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    452819 (ADCY4)
   05163 Human cytomegalovirus infection
    452819 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    452819 (ADCY4)
Enzymes [BR:ptr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     452819 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N DUF3180 CD52
Other DBs
NCBI-GeneID: 452819
NCBI-ProteinID: XP_009425872
Ensembl: ENSPTRG00000006216
VGNC: 3507
UniProt: H2Q832
Position
14
AA seq 1077 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALAALLAVAWASGRELTSDPS
FLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWVALLALGHAFLFTGGVVSAWDQV
SYFLFVIFTAYAMLPLGMRDAAVAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVAGVYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGLKMRPSLLMTR
YLESWGAAKPFAHLSHGDSPVSTSTPLPEKTLASFSTQWSLDRSRTPRGLDDELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSAIPAFKYYEACTFLVFLSNFI
IQMLVTNRPPALAITYSITFLLFLLILFVCFSEDLMRCVLKGPKMLHWLPALSGLVATRP
GLRIALGTTTILLVFAMAVTSLFFFPTSSDCPFQAPNVSSMISNLSWELPGSLPLISVPY
SMHCCTLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSECLIVRLYLGPLDS
RPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMV
EFAMALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETAWALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3234 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagcccccggccgccccccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccgctgctgctgctgctgctggggatcgtgctctgtgcg
ctcgcggcgctgctcgccgtggcctgggccagcggcagggagctgacctcagacccgagc
ttcctgaccactgtgctgtgcgcgctgggcggcttctcgctgctgctgggcctcgcttcc
cgggagcagcgactgcagcgctggacgcgtcccctgtccggcttggtatgggtcgcgctg
ctagcgctaggccacgccttcctgttcaccgggggcgtggtgagcgcctgggaccaggtg
tcctattttctcttcgtcatcttcacggcgtatgccatgctgcccttgggcatgcgggac
gccgccgtcgcgggcctcgcctcctcactctcgcatctgctggtcctcgggctgtatctt
gggccacagccggactcacggcctgcactgctgccgcagttggcagcaaacgcagtgctg
ttcctgtgcgggaacgtggcaggagtgtaccacaaggcgctgatggagcgcgccctgcgg
gccacgttccgggaggcactcagctccctgcactcacgccggcggctggacaccgagaag
aaacaccaggaacaccttctcttgtccatccttcctgcctacctggcccgagagatgaag
gcagagatcatggcacggctgcaggcaggacaggggtcacggccagagagcactaacaat
ttccacagcctctatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcacacggctggccagcgagtgttcccctaaggagctggtgctcatgctcaatgag
ctctttggcaagttcgaccagattgccaaggagcatgaatgcatgcggatcaagatcctg
ggggactgttactactgtgtctctgggctgccactctcactgccagaccatgccatcaac
tgcgtgcgcatgggcctggacatgtgccgggccatcaggaaactgcgggcagccactggc
gtggacatcaacatgcgtgtgggcgtgcactcaggcagcgtactgtgtggagtcatcggg
ctgcagaagtggcagtacgacgtttggtcccatgatgtcacactggctaaccacatggag
gcaggcggtgtaccagggcgagtgcacatcacaggggctaccctggccctgctggcaggg
gcttatgctgtggaggacgcaggcatggagcatcgggacccctaccttcgggagctaggg
gagcctacctatctggtcatcgatccacgggcagaggaggaggatgagaagggcactgca
ggaggcttgctgtcctcgcttgagggcctcaagatgcgtccatcactgctgatgacccgt
tacctggagtcctggggcgcagccaagccttttgcccacctgagccacggagacagccct
gtgtccacctccacccctctcccggagaagaccctggcttccttcagcacccagtggagc
ctggatcggagccgtaccccccggggactagatgatgaactggacaccggggatgccaag
ttcttccaggtcattgagcagctcaactcgcagaaacagtggaagcagtcgaaggacttc
aaccccctgacactgtacttcagagagaaggagatggagaaagagtaccgactctctgca
atccccgccttcaaatactatgaagcctgcaccttcctggtttttctctccaacttcatc
atccagatgctagtgacaaacaggcccccagctctggccatcacgtatagcatcaccttc
ctcctcttcctcctcatcctttttgtctgcttctcagaggacctgatgaggtgtgtcctg
aaaggccccaagatgctgcactggctgcctgcactgtctggcctggtggccacacgacca
ggactgagaatagccttgggcaccaccaccatcctccttgtctttgccatggccgttacc
agcctgttcttcttcccaacatcatcagactgccctttccaagctcccaatgtgtcctcc
atgatttccaacctctcctgggagctccctgggtctctgcctctcatcagtgtcccatac
tccatgcactgctgcacgctgggcttcctctcctgctccctctttctgcacatgagcttc
gagctgaagctgctgctgctcctgctgtggctggcggcatcctgctccctcttcctgcac
tcccacgcctggctgtccgaatgcctcatcgtccgcctctatctgggccccttggactcc
aggcccggagtgctgaaggagcccaaactgatgggtgctatctccttcttcatcttcttc
ttcaccctccttgtcctggctcgccagaatgagtactactgccgcctggacttcctgtgg
aagaagaagctgaggcaggagagggaggagacagagacgatggagaacctgactcggctg
ctcttggagaacgtgctccctgcacacgtggccccccagttcattggccagaaccggcgc
aacgaggatctctaccaccagtcctatgaatgcgtttgtgtcctcttcgcctcagtccca
gacttcaaggagttctactctgaatccaacatcaatcatgagggcctagagtgtctgagg
ctgctcaatgagataattgctgattttgatgagctgctctccaagcccaagttcagtggg
gtggagaagatcaagaccatcggcagcacctacatggcagccacaggcttaaatgccacc
tctggacaggatgcacaacaggatgctgaacggagctgcagccaccttggcactatggtg
gaatttgccatggccctggggtctaagctggacgtcatcaacaagcattcattcaacaac
ttccgcctgcgagtggggttgaaccatggacccgtagtagctggagttattggggcccag
aagccgcaatatgacatttggggcaacacagtgaacgtggccagccgcatggagagtaca
ggagtccttggcaaaatccaagtgactgaggagacagcatgggccctacagtccctgggc
tacacctgctacagccggggtgtcatcaaggtgaaaggcaaagggcagctctgcacctac
ttcctgaacacagacttgacacgaactggacctccttcagctaccctaggctga

DBGET integrated database retrieval system