KEGG   Pan troglodytes (chimpanzee): 453356Help
Entry
453356            CDS       T01005                                 

Gene name
PLA2G4F
Definition
(RefSeq) cytosolic phospholipase A2 zeta isoform X2
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00564  Glycerophospholipid metabolism
ptr00565  Ether lipid metabolism
ptr00590  Arachidonic acid metabolism
ptr00591  Linoleic acid metabolism
ptr00592  alpha-Linolenic acid metabolism
ptr01100  Metabolic pathways
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04217  Necroptosis
ptr04270  Vascular smooth muscle contraction
ptr04370  VEGF signaling pathway
ptr04611  Platelet activation
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04724  Glutamatergic synapse
ptr04726  Serotonergic synapse
ptr04730  Long-term depression
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04912  GnRH signaling pathway
ptr04913  Ovarian steroidogenesis
ptr04921  Oxytocin signaling pathway
ptr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    453356 (PLA2G4F)
   00565 Ether lipid metabolism
    453356 (PLA2G4F)
   00590 Arachidonic acid metabolism
    453356 (PLA2G4F)
   00591 Linoleic acid metabolism
    453356 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    453356 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    453356 (PLA2G4F)
   04010 MAPK signaling pathway
    453356 (PLA2G4F)
   04370 VEGF signaling pathway
    453356 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    453356 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    453356 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    453356 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    453356 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    453356 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    453356 (PLA2G4F)
   04913 Ovarian steroidogenesis
    453356 (PLA2G4F)
   04921 Oxytocin signaling pathway
    453356 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    453356 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    453356 (PLA2G4F)
   04726 Serotonergic synapse
    453356 (PLA2G4F)
   04730 Long-term depression
    453356 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    453356 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    453356 (PLA2G4F)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     453356 (PLA2G4F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 453356
NCBI-ProteinID: XP_009427162
Ensembl: ENSPTRG00000006970
VGNC: 8285
Position
15
AA seq 690 aa AA seqDB search
MLWALRPRWLADKMLPLLGAVLLQKREKRGPLWRHWRRETYPYYDLQVKVLRATNIRGTD
LLSKADCYVQLWLPTASPSPAQTRIVANCSDPEWNETFHYQIHGAVKNVLELTLYDKDIL
GSDQLSLLLFDLRSLKCGLPHKHTFPLNHQDSQELQVEFVLEKSQVPASEVITNGVLVAH
PCLRIQGTLRGDGTAPRGEYGSRQLQLAVPGAYEKPQLLPLQPPTEPGLPPTFTFHVNPV
LSSRLHVELMELLAAVQSGPSAELEAQTSKLGEGGILLSSLPLGQEEQCSVALGEGQEVA
LSMKVEMSSGDLDLRLGFDLCDGEQKFLDRRKQVVSKALQQVLGLSEAPDSGQVPVVAVL
GSGGGTRAMSSLYGSLAGLQELGLLDTVTYLSGVSGSTWCISTLYRDPAWSQVALQGPIE
RAQVHVCSSKMGALSTERLQYYTQELGVREHSGHSVSLIDLWGLLVEYFLYQEENPAKLS
DQQEAVRQGQNPYPIYTSVNVRTNLSGEDFAEWCEFTPYEVGFPKYGAYVPTELFGSELF
MGRLLQLQPEPRICYLQGMWGSAFATSLDEIFLKTAGSGLSFLEWYRGSVNITDDCQKPQ
LHNPSRLRTRLLTPQGPFSQAVLDIFTSRFTSAQSFNFTQGLCLHKDYVAGREFVAWKGL
PVPGGRRLCHQLSVPTGSAASESSGPHSVL
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgctttgggcactccggccaaggtggctggcagacaagatgctgcccctcctgggggca
gtgctgcttcagaagagagagaagaggggccctctgtggaggcactggcggcgggaaacc
tacccatactatgacctccaggtgaaggtgctgagggccacaaacatccggggcacagac
ctgctgtccaaagccgactgctatgtgcaactgtggctgcccacggcgtccccaagccct
gcccagactaggatagtggccaactgcagtgaccccgagtggaatgagaccttccactac
cagatccatggtgctgtgaagaacgtcctggagctcaccctgtatgacaaggacatcctg
ggcagcgaccagctctctctgctcctgtttgacctgagaagcctcaagtgtggcctacct
cacaaacacaccttcccactcaaccaccaggattcacaagagctgcaggtggaatttgtt
ctggagaagagccaggtgcctgcatctgaagtcatcaccaacggggttctggtggctcac
ccctgtctgagaatccagggcacactccggggagatgggacagccccacggggagagtac
ggctctaggcagctccagctggcagtgcctggggcctacgagaagccacagctcttgccc
ctgcagcctcccacagagccaggcctcccacccacctttaccttccacgtgaacccagtg
ctgagctccaggctacacgtggagctgatggagctgctggcggctgtgcagagtggcccc
agcgcggagctggaggctcagaccagcaagctgggcgaggggggcatcctgctctcctct
ctgcccctaggccaggaggaacagtgttctgtggccctgggggagggccaggaggtggct
ctgagcatgaaggtggaaatgagctccggggacctagacctacgccttggctttgacctc
tgtgacggggagcagaagtttctggacaggaggaagcaggtcgtgtccaaggccctgcag
caagtgctgggattgagtgaggctccggacagtggccaggtgcctgtagtggctgtgttg
ggttccgggggtggaacccgagccatgtcttctctgtacggcagcctggcagggttgcag
gagctcggccttctagacactgtgacctacctgagtggggtctctgggtctacctggtgc
atctccacactctacagggacccagcctggtcccaggtggccttgcagggccccattgag
cgtgcccaggttcacgtctgcagcagtaagatgggagctttgtccacggagcggctacag
tactacactcaggaactgggggtccgggagcacagtggccacagcgtgtccctcatcgac
ctctggggcctccttgttgagtatttcctgtaccaggaggagaaccctgccaagctgtct
gaccaacaggaggcagtccgccagggtcagaacccttaccccatttacaccagcgtcaac
gtccgcaccaacttgagtggagaagattttgcagagtggtgcgagttcacgccctatgag
gtaggcttccccaagtacggggcttatgttcccaccgagctcttcggctcagaactcttc
atgggacgattgctgcagctccagcctgaaccccggatctgttacctgcaaggtatgtgg
ggcagcgcctttgccaccagcctggatgagatcttcctaaagaccgccggctcgggcctc
agcttcctggagtggtacagaggcagtgtgaatatcacagacgactgccagaagcctcag
ctgcacaacccctcgaggctgcgaacgaggctcctcaccccgcaggggcccttctcccag
gctgtgctggacatattcacctcccgcttcacttccgcccagagctttaacttcacccag
ggtctctgcttgcacaaggactatgtggctggcagggagttcgtggcctggaaaggactg
cctgtacctggtggacggaggctttgccatcaactctccgttcccactggctctgctgcc
tcagagagcagtggacctcattctgtcctttga

DBGET integrated database retrieval system