KEGG   Pan troglodytes (chimpanzee): 453585Help
Entry
453585            CDS       T01005                                 

Gene name
CEMIP
Definition
(RefSeq) cell migration-inducing and hyaluronan-binding protein
  KO
K19031  cell migration-inducing and hyaluronan-binding protein [EC:3.2.1.35]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ptr00536]
    453585 (CEMIP)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.35  hyaluronoglucosaminidase
     453585 (CEMIP)
Glycosaminoglycan binding proteins [BR:ptr00536]
 Hyaluronan
  Cell surface receptors
   453585 (CEMIP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ILEI G8 Mucin2_WxxW
Motif
Other DBs
NCBI-GeneID: 453585
NCBI-ProteinID: XP_001156578
Ensembl: ENSPTRG00000007365
VGNC: 10167
UniProt: H2Q9Y0
Position
15
AA seq 1361 aa AA seqDB search
MGAAGRQDFFFKAMLTISWLTLTCFPGATSTVAAGCPDQSPELQPWNPGHDQDHHVHIGQ
GKTLLLTSSATVYSIHISEGGKLVIKDHDEPIVLRTRHILIDNGGELHAGSALCPFQGNF
TIILYGRADEGIQPDPYYGLKYIGVGEGGTLELHGQKKLSWTFLNKTLHPGGMAEGGYFF
ERSWGHRGVIVHVIDPKSGTVIHSDRFDTYRSKKESERLVQYLNAVPDGRILSVAVNDEG
SRNLDDMARKAMTKLGSKHFLHLGFRHPWSFLTVKGNPSSSVEDHIEYHGHRGSAAARVF
KLFQTEHGEYFNVSLSSEWVQDVEWTEWFDHDKVSQTKGGEKISDLWKAHPGKICNRPID
IQATTMDGVNLSTEVVYKKGQDYRFACYDRGRACRSYRVRFLCGKPVRPKLTVTIDTNVN
STILNLEDNVQSWKPGDTLVIASTDYSMYQAEEFQVLPCRSCAPNQVKVAGKPMYLHIGE
EIDGVDMRAEVGLLSRNIIVMGEMEDKCYPYRNHICNFFDFDTFGGHIKFALGFKAAHLE
GMELKLMGQQLMGQYPIHFHLAGDVDERGGYDPPTYIRDLSIHHTFSRCVTVHGSNGLLI
KDVVGYNSLGHCFFTEDGPEERNTFDHCLGLLVKSGTLLPSDRDSKMCKMITEDSYPGYI
PKPRQDCNAVSTFWMANPNNNLINCAAAGSEETGFWFIFHHVPTGPSVGMYSPGYSEHIP
LGKFYNNRAHSNYRAGMIIDNGVKTTEASAKDKRPFLSIISARYSPHQDADPLKPREPAI
IRHFIAYKNQDHGAWLRGGDVWLDSCRFADNGIGLTLASGGTFPYDDGSKQEIKNSLFVG
ESGNVGTEMMDNRIWGPGGLDHSGRTLPIGQNFPIRGIQLYDGPINIQNCTFRKFVALEG
RHTSALAFRLNNAWQSCPHNNVTGIAFEDVPITSRVFFGEPGPWFNQLDMDGDKTSVFHD
VDGSVSEYPGSYLTKNDNWLVRHPDCINVPDWRGAICSGRYAQMYIQAYKTSNLRMKIIK
NDFPSHPLYLEGALTRSTHYQQYQPVVTLQKGYTIHWDQTAPAELAIWLINFNKGDWIRV
GLCYPRGTTFSILSDVHNRLLKQTSKTGVFVRTLQMDKVEQSYPGRSHYYWDEDSGLLFL
KLKAQNEREKFAFCSMKGCERIKIKALIPKNAGVSDCTATAYPKFTERAVVDVPMPKKLF
GSQLKTKDHFLEVKMESSKQHFFHLWNDFAYIEVDGKKYPSSEDGIQVVVIDGNQGRVVS
HTSFRNSILQGIPWQLFNYVATIPDNSIVLMASKGRYVSRGPWTRVLEKLGADRGLKLKE
QMAFVGFKGSFRPIWVTLDTEDHKAKIFQVVPIPVVKKNKL
NT seq 4086 nt NT seq  +upstreamnt  +downstreamnt
atgggagctgctgggaggcaggacttcttcttcaaggccatgctgaccatcagctggctc
actctgacctgcttccctggggccacatccacagtggctgctgggtgccctgaccagagc
cctgagttgcaaccctggaaccctggccatgaccaagaccaccatgtgcatatcggccag
ggcaagacactgctgctcacctcttctgccacggtctattccatccacatctcagaggga
ggcaagctagtcattaaagaccacgacgagccgattgttttgcgaacccggcacatcctg
attgacaacggaggagagctgcatgctgggagtgccctctgccctttccagggcaatttc
accatcattttgtatggaagggctgatgaaggtattcagccagatccttactatggtctg
aagtacattggggttggtgaaggaggcactcttgagttgcatggacagaaaaagctctcc
tggacatttctgaacaagacccttcacccaggtggcatggcagaaggaggctattttttt
gaaaggagctggggccaccgtggagttattgttcatgtcatcgaccccaaatcaggcaca
gtcatccattctgaccggtttgacacctatagatccaagaaagagagtgaacgtctggtc
cagtatttgaacgcggtgcccgatggcaggatcctttctgttgcagtgaatgatgaaggt
tctcgaaatctggatgacatggccaggaaggcgatgaccaaattgggaagcaaacacttc
ctgcaccttggatttagacacccttggagttttctaactgtgaaaggaaatccatcatct
tcagtggaagaccatattgaatatcatggacatcgaggctctgctgctgcccgggtattc
aaattgttccagacagagcatggcgaatatttcaatgtttctttgtccagtgagtgggtt
caagacgtggagtggacggagtggttcgatcatgataaagtatctcagactaaaggtggg
gagaaaatttcagacctctggaaagctcacccaggaaaaatatgcaatcgtcccattgat
atacaggccactacaatggatggagttaacctcagcaccgaggttgtctacaaaaaaggc
caggattataggtttgcttgctacgaccggggcagagcctgccggagctaccgtgtacgg
ttcctctgtgggaagcctgtgaggcccaaactcacagtcaccattgacaccaatgtgaac
agcaccattctgaacttggaggataatgtacagtcatggaaacctggagataccctggtc
attgccagtactgattactccatgtaccaggcagaagagttccaggtgcttccctgcaga
tcctgcgcccccaaccaggtcaaagtggcagggaaaccaatgtacctgcacatcggggag
gagatagacggcgtggacatgcgggcggaggttgggcttctgagccggaacatcatagtg
atgggggagatggaggacaaatgctacccctacagaaaccacatctgcaatttctttgac
ttcgatacctttgggggccacatcaagtttgctctgggatttaaggcagcacacctggag
ggcatggagctgaagcttatgggacagcagctgatgggtcagtacccgattcacttccac
ctggctggtgatgtagacgaaaggggaggttatgacccacccacatacatcagggacctc
tccatccatcatacattctctcgctgcgtcacagtccatggctccaatggcttgttgatc
aaggacgttgtgggctataactctttgggccactgcttcttcacggaagatgggccggag
gaacgcaacacttttgaccactgtcttggcctccttgtcaagtctggaaccctcctcccc
tcggaccgtgacagcaagatgtgcaagatgatcacagaggactcctacccggggtacatc
cccaagcccaggcaagactgcaatgctgtgtccaccttctggatggccaatcccaacaac
aacctcatcaactgtgccgctgcaggatctgaggaaactggattttggtttatttttcac
cacgtaccaacgggcccctccgtgggaatgtactccccaggttattcagagcacattcca
ctgggaaaattctataacaaccgagcacattccaactaccgggctggcatgatcatagac
aacggagtcaaaaccaccgaggcctctgccaaggacaagcggccgttcctctcgatcatc
tctgccagatacagccctcaccaggacgccgacccgctgaagccccgggagccggccatc
atcagacacttcattgcctacaagaaccaggaccacggggcctggctgcgcggcggggat
gtgtggctggacagctgccggtttgctgacaatggcattggcctgaccctggccagtggt
ggaaccttcccatatgatgacggctccaagcaagagataaagaacagcttgtttgttggc
gagagtggcaacgtggggacggaaatgatggacaataggatctggggccctggcggcttg
gaccatagcggaaggaccctccctataggccagaattttccaattagaggaattcagtta
tatgatggccccatcaacatccaaaactgcactttccgaaagtttgtggccctggagggc
cggcacaccagcgccctggccttccgcctgaataatgcctggcagagctgcccccataac
aacgtgaccggcattgcctttgaggacgttccgattacttccagagtgttcttcggagag
cccgggccctggttcaaccagctggacatggatggggataagacatctgtgttccatgac
gtcgacggctccgtgtccgagtaccctggctcctacctcacgaagaatgacaactggctg
gtccggcacccagactgcatcaatgttcccgactggagaggggccatttgcagtgggcgc
tatgcacagatgtacattcaagcctacaagaccagtaacctgcgaatgaagatcatcaag
aatgacttccccagccaccctctctacctggagggggcgctcaccaggagcacccattac
cagcaataccaaccggttgtcaccctgcagaagggctacaccatccactgggaccagacg
gcccccgccgaactcgccatctggctcatcaacttcaacaagggcgactggatccgagtg
gggctctgctacccgcgaggcaccacattttccatcctctcggatgttcacaatcgcctg
ctgaagcaaacgtccaagacgggcgtcttcgtgaggaccttgcagatggacaaagtggag
cagagctaccctggcaggagccactactactgggacgaggactcagggctgttgttcctg
aagctgaaagctcagaacgagagagagaagtttgctttctgctccatgaaaggctgtgag
aggataaaaattaaagctctgattccaaagaacgcaggcgtcagtgactgcacagccaca
gcctaccccaagttcaccgagagggctgtcgtggacgtgccgatgcccaagaagctcttt
ggttctcagctgaaaacaaaggaccatttcttggaggtgaagatggagagttccaagcag
cacttcttccacctctggaacgacttcgcttacattgaagtggatgggaagaagtacccc
agttcggaggatggcatccaggtggtggtgattgacgggaaccaagggcgcgtggtgagc
cacacgagcttcaggaactccattctgcaaggcataccatggcagcttttcaactatgtg
gcgaccatccctgacaattccatagtgcttatggcatcaaagggaagatacgtctccaga
ggcccatggaccagagtgctggaaaagcttggggcagacaggggtctcaagttgaaagag
caaatggcattcgttggcttcaaaggcagcttccggcccatctgggtgacactggacact
gaggatcacaaagccaaaatcttccaagttgtgcccatccctgtggtgaagaagaacaag
ttgtga

DBGET integrated database retrieval system