KEGG   Pan troglodytes (chimpanzee): 454039
Entry
454039            CDS       T01005                                 

Gene name
BOLA2B
Definition
(RefSeq) bolA-like protein 2 isoform X2
Organism
ptr  Pan troglodytes (chimpanzee)
SSDB
Motif
Pfam: GETHR
Other DBs
NCBI-GeneID: 454039
NCBI-ProteinID: XP_016784304
Ensembl: ENSPTRG00000007990
Position
16
AA seq 123 aa
MASAKSLDRWKARLLEGGSTALTYALVRAEVSFPAEVAPVRQQGSVAGVRAGVVSLLGCR
SSWTVAMELSAEYLREKLQRNLEAEHVLPSPGGVGQVRGETAASETQAGERVPSRRAPAH
PCL
NT seq 372 nt   +upstreamnt  +downstreamnt
atggcaagcgcgaaaagcctggaccgctggaaagcccggctgcttgagggcggaagtact
gcgttgacgtacgccttagtaagggcggaagtgagttttccagcggaagtggctcctgta
aggcagcaaggtagcgtggccggcgtccgagcaggggttgtgtccctgctgggctgccgt
tccagctggacggtcgccatggaactcagcgccgaatacctccgcgagaagctgcagcgg
aacctggaggcggagcatgtgcttccgagtcctggtggtgtcggccaagttcgaggggaa
accgctgcttcagagacacaggctggtgaacgcgtgcctagcagaagagctcccgcacat
ccatgcctttga

DBGET integrated database retrieval system