KEGG   Pan troglodytes (chimpanzee): 454350Help
Entry
454350            CDS       T01005                                 

Gene name
EEF2K
Definition
(RefSeq) eukaryotic elongation factor 2 kinase isoform X1
  KO
K08292  elongation factor 2 kinase [EC:2.7.11.20]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04152  AMPK signaling pathway
ptr04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    454350 (EEF2K)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    454350 (EEF2K)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     454350 (EEF2K)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: Other
  Alpha family [OT]
   454350 (EEF2K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha_kinase Sel1
Motif
Other DBs
NCBI-GeneID: 454350
NCBI-ProteinID: XP_001161085
Ensembl: ENSPTRG00000007877
VGNC: 5755
UniProt: A0A2I3TJP1
Position
16
AA seq 725 aa AA seqDB search
MADEDLIFRLEGVDGSQSPRAGRDGDSDGDSDDEEGYFICPITDDPSSNQNVNSKVNKYY
SNLTKSERYSSSGSPANSFHFKEAWKHAIQKAKHMPDPWAEFHLEDIATERATRHRYNAV
TGEWLDDEVLIKMASQPFGRGAMRECFRTKKLSNFLHAQQWKGASNYVAKRYIEPVDRDV
YFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKDRPGKPLFHLEHYIEGKYIKYN
SNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTETGTDFGDGNL
GVRGMALFFYSHACNRICESMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSP
RVRTLSGSRPPLLRPLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLDN
MASRDHDHLDNHRESENSGDSGYPSEKRGELDDPEPREHGHSYSNQKYESDEDSLGSSGR
VCVEKWNLLNSSRLHLPRASAVALEVQRLNALDLEKKIGKSILGKVHLAMVRYHEGGRFC
EKGEEWDQESAVFHLEHAADLGELEAIVGLGLMYSQLPHHILADVSLKETEENKTKGFDY
LLKAAEAGDRQSMILVARAFDTGQNLSPDRCQDWLEALHWYNTALEMTDCDEGGEYDGMQ
NEPRYMMLAREAEMLFTGGYGLEKDPQRSGDLYTQAAEAAMEAMKGRLANQYYQKAEEAW
AQMEE
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgaagatctcatcttccgcctggaaggcgttgatggcagccagtccccccga
gctggccgtgatggtgattctgatggggacagcgacgatgaggaaggttacttcatctgc
cccatcacggatgacccaagctcaaaccagaatgtcaattccaaggttaataagtactac
agcaacctaacaaaaagtgagcggtatagctccagcgggtccccggcaaactccttccac
ttcaaggaagcctggaagcacgcaatccagaaggccaagcacatgcccgacccctgggct
gagttccacctggaagatattgccaccgaacgtgctactcgacacaggtacaacgccgtc
accggggaatggctggatgatgaagttctgatcaagatggcatctcagcccttcggccga
ggagcaatgagggagtgcttccggacgaagaagctctccaacttcttgcatgcccagcag
tggaagggagcctccaactacgtggcgaagcgctacatcgagcccgtagaccgggatgtg
tactttgaggacgtgcgtctacagatggaggccaagctctggggggaggagtataatcgg
cacaagccccccaagcaggtggacatcatgcaaatgtgcatcatcgagctgaaggacaga
ccgggcaagcccctcttccacctggagcactacatcgagggcaagtacatcaagtacaac
tccaactctggctttgtccgcgatgacaacatccgcctgacgccgcaggccttcagccac
ttcacttttgagcgttccggccatcagctgatagtggtggacatccagggagttggggat
ctctacactgacccacagatccacacggagacgggcactgactttggagacggcaaccta
ggtgtccgcgggatggcgctcttcttctactctcatgcctgcaaccggatttgcgagagc
atgggccttgctccctttgacctctcgccccgggagagggatgcggtgaatcagaacacc
aagctgctgcaatcagccaagaccatcttgagaggaacagaggaaaaatgtgggagcccc
cgagtaaggaccctctctgggagccggccacccctgctccgtcccctttcagagaactct
ggagacgagaacatgagcgacgtgaccttcgactctctcccttcttccccatcttcggcc
acaccacacagccagaagctagaccacctccattggccagtgttcagtgaccttgataac
atggcatccagagaccatgatcatctagacaaccaccgggagtctgagaatagtggggac
agcggataccccagtgagaagcggggtgagctggatgaccctgagccccgagaacatggc
cactcatacagtaatcagaagtacgagtctgacgaagacagcctgggcagctctggacgg
gtatgtgtagagaagtggaatctcctcaactcctcccgcctccacctgccgagggcttcg
gccgtggccctggaagtgcaaaggcttaatgctctggacctcgaaaagaaaatcgggaag
tccattttggggaaggtccatctggccatggtgcgctaccacgagggtgggcgcttctgc
gagaagggcgaggagtgggaccaggagtcggctgtcttccacctggagcacgcagccgac
ctgggcgagctggaggccatcgtgggcctgggactcatgtactcgcagttgcctcatcac
atcctagccgatgtctctctgaaggagacagaagagaacaaaaccaaaggatttgattac
ttactaaaggccgctgaagctggcgacaggcagtccatgatcctagtggcgcgagctttt
gacactggccagaacctcagcccggacaggtgccaagactggctagaggccctgcactgg
tacaacactgccctggagatgacggactgtgatgagggcggtgagtacgatggaatgcag
aacgagccccggtacatgatgctggccagggaggccgagatgctgttcacaggaggctac
gggctggagaaggacccacagagatcaggggacttgtatacccaggcagcagaggcagcg
atggaagccatgaagggccgactggccaaccagtactaccaaaaggctgaagaggcctgg
gcccagatggaggagtaa

DBGET integrated database retrieval system