KEGG   Pan troglodytes (chimpanzee): 454378Help
Entry
454378            CDS       T01005                                 

Gene name
CES3
Definition
(RefSeq) carboxylesterase 3 isoform X7
  KO
K15743  carboxylesterase 3/5 [EC:3.1.1.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     454378 (CES3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase
Motif
Other DBs
NCBI-GeneID: 454378
NCBI-ProteinID: XP_009429241
Ensembl: ENSPTRG00000008210
VGNC: 5731
Position
16
AA seq 231 aa AA seqDB search
MGVNNHEFSWLIPRGWGLLDTMEQMSREDMLAISTPVLTSLDVPPEMMPTVIDEYLGSNS
DAQAKCQAFQEFMGDVFINVPTVSFSRYLRDSGSPVFFYEFQHRPSSFAKIKPTWVKADH
AAEGAFVFGGPFLMDESSRLAFPEATEEEKQLSLTMMAQWTHFARTGDPNSKALPPWPRF
NQAEQYLEINPVPRARQKFREARMQFWSETLPSKIQQWHQKQKNRKAQEDL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtcaacaaccatgagttcagctggctcatccccaggggctggggtctcctggat
acaatggagcagatgagccgggaggacatgctggccatctcaacacccgtcttgaccagt
ctggatgtgccccctgagatgatgcccaccgtcatagatgaatacctaggaagcaactcg
gacgcacaagccaaatgccaggcattccaggaattcatgggtgacgtattcatcaatgtt
cccaccgtcagtttttcaagataccttcgagattctggaagccctgtctttttctatgag
ttccagcatcgacccagttcttttgcaaagatcaaacccacctgggtgaaggctgatcat
gccgctgagggtgcttttgtgttcggaggtcccttcctcatggacgagagctcccgcctg
gcctttccagaggccacagaggaggagaagcagctaagcctcaccatgatggcccagtgg
acccactttgcccggacaggggaccccaatagcaaggctctgcctccttggccccgattc
aaccaggcggaacaatatctggagatcaacccagtgccacgggccagacagaagttcagg
gaggcccggatgcagttctggtcagagacgctccccagcaagatacaacagtggcaccag
aagcagaagaacaggaaggcccaggaggacctctga

DBGET integrated database retrieval system