KEGG   Pan troglodytes (chimpanzee): 454450Help
Entry
454450            CDS       T01005                                 

Gene name
ARRB2
Definition
(RefSeq) beta-arrestin-2 isoform X2
  KO
K04439  beta-arrestin
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04062  Chemokine signaling pathway
ptr04144  Endocytosis
ptr04340  Hedgehog signaling pathway
ptr04740  Olfactory transduction
ptr04926  Relaxin signaling pathway
ptr04928  Parathyroid hormone synthesis, secretion and action
ptr05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    454450 (ARRB2)
   04340 Hedgehog signaling pathway
    454450 (ARRB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    454450 (ARRB2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    454450 (ARRB2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    454450 (ARRB2)
   04928 Parathyroid hormone synthesis, secretion and action
    454450 (ARRB2)
  09157 Sensory system
   04740 Olfactory transduction
    454450 (ARRB2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    454450 (ARRB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    454450 (ARRB2)
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    454450 (ARRB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arrestin_N Arrestin_C SCA7
Motif
Other DBs
NCBI-GeneID: 454450
NCBI-ProteinID: XP_009429931
Ensembl: ENSPTRG00000008601
VGNC: 9221
UniProt: K7D106
Position
17
AA seq 409 aa AA seqDB search
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTI
PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPG
PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLSVNVHVTNNSTKTVKKIKVSVRQYA
DICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTN
LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQS
AAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgggggagaaacccgggaccagggtcttcaagaagtcgagccctaactgcaagctcacc
gtgtacttgggcaagcgggacttcgtagatcacctggacaaagtggaccctgtagatggc
gtggtgcttgtggaccctgactacctgaaggaccgcaaagtgtttgtgaccctcacctgc
gccttccgctatggccgtgaagacctggatgtgctgggcttgtccttccgcaaagacctg
ttcatcgccacctaccaggccttccccccggtgcccaacccgccccggccccccacccgc
ctgcaggaccggctgctgaggaagctgggccagcatgcccaccccttcttcttcaccata
ccccagaatcttccatgctccgtcacactgcagccaggcccagaggatacagggaaggcc
tgcggcgtagactttgagattcgagccttctgtgctaaatcactagaagagaaaagccac
aaaaggaactccgtgcggctggtgatccgaaaggtgcagttcgccccagagaaacccggc
ccccagccttcagccgaaaccacacgccacttcctcatgtctgaccggtccctgcacctc
gaggcttccctggacaaggagctgtactaccatggggagcccctcagtgtaaatgtccac
gtcaccaacaactccaccaagaccgtcaagaagatcaaagtctctgtgagacagtacgcc
gacatctgcctcttcagcaccgcccagtacaagtgtcctgtggctcaactcgaacaagat
gaccaggtatctcccagctccacattctgtaaggtgtacaccataaccccactgctcagc
gacaaccgggagaagcggggtctcgccctggatgggaaactcaagcacgaggacaccaac
ctggcttccagcaccatcgtgaaggagggtgccaacaaggaggtgctgggaatcctggtg
tcctacagggtcaaggtgaagctggtggtgtctcgaggcggggatgtctctgtggagctg
ccttttgttcttatgcaccccaagccccacgaccacatccccctccccagaccccagtca
gccgctccggagacagatgtccctgtggacaccaacctcattgaatttgataccaactat
gccacagatgatgacattgtgtttgaggactttgcccggcttcggctgaaggggatgaag
gatgacgactatgatgatcaactgtgctag

DBGET integrated database retrieval system