KEGG   Pan troglodytes (chimpanzee): 454499Help
Entry
454499            CDS       T01005                                 

Gene name
MAPK7
Definition
(RefSeq) mitogen-activated protein kinase 7 isoform X3
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04540  Gap junction
ptr04657  IL-17 signaling pathway
ptr04722  Neurotrophin signaling pathway
ptr04912  GnRH signaling pathway
ptr04921  Oxytocin signaling pathway
ptr05206  MicroRNAs in cancer
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    454499 (MAPK7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    454499 (MAPK7)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    454499 (MAPK7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    454499 (MAPK7)
   04921 Oxytocin signaling pathway
    454499 (MAPK7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    454499 (MAPK7)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    454499 (MAPK7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    454499 (MAPK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    454499 (MAPK7)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     454499 (MAPK7)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   454499 (MAPK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo APH Haspin_kinase Rrn6
Motif
Other DBs
NCBI-GeneID: 454499
NCBI-ProteinID: XP_009430868
Ensembl: ENSPTRG00000008867
VGNC: 12424
Position
17
AA seq 822 aa AA seqDB search
MAEPLKEEDGEDGSAEPPGPVKAEPAHTAASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVPYGVPGYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMH
SAQVIHRDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELML
SLHEYTQAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERV
RAYIQSLPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPD
DEPDCAPPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGC
PDVEMPSPWAPSGDCAMESPPPAPPPCPGPAPDTIDLTLQPPPPVSEPAPPKKEGAISDN
TKAALKAALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKR
RQERERKERGAGASGGPSTDPLAGLVLSDNDRSLLERWTRMARPAAPAPTSVPAPAPAPT
PTPTPVQPTSPLPGPVAQPTGPQPQPAGSTSGPVPQPACPPLGPAPHPTGPPGPIPVPVP
PQIATSTSLLAAQSLVPPPGLPGSSTPGILPYFPPGLPPPDAGGAPQSSMSESPDVNLVT
QQLSKSQVEDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLS
ASLLADWLEGHGMNPADIESLQREIQMDSPMLLADLPDLQDP
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcctctgaaggaggaagacggcgaggacggctctgcggagccccccgggccc
gtgaaggccgaacccgcccacaccgctgcctctgtagcggccaagaacctggccctgctt
aaagcccgctccttcgatgtgacctttgacgtgggcgacgagtacgagatcatcgagacc
ataggcaacggggcctatggagtggtgtcctccgcccgccgccgcctcaccggccagcag
gtggccatcaagaagatccctaatgctttcgatgtggtgaccaatgccaagcggaccctc
agggagctgaagatcctcaagcactttaaacacgacaacatcatcgccatcaaggacatc
ctgaggcccaccgtgccctatggcgaattcaaatctgtcccctacggggtcccaggctac
gtggtcctggacctgatggaaagcgacctgcaccagattatccactcctcacagcccctc
acactggaacacgtgcgctacttcctgtaccaactgctgcggggcctgaagtacatgcac
tcggctcaggtcatccaccgtgacctcaagccctccaacctattggtgaatgagaactgt
gagctcaagattggtgactttggtatggctcgtggcctgtgcacctcgcccgctgaacat
cagtacttcatgactgagtatgtggccacgcgctggtaccgtgcgcccgagctcatgctc
tctttgcatgagtatacacaggctattgacctctggtctgtgggctgcatctttggtgag
atgctggcccggcgccagctcttcccaggcaaaaactacgtacaccagctacagctcatc
atgatggtgctgggtaccccatcaccagccgtgattcaggctgtgggggctgagagggtg
cgggcctatatccagagcttgccaccacgccagcctgtgccctgggagacagtgtaccca
ggtgccgaccgccaggccctatcactgctgggtcgcatgctgcgttttgagcccagcgcc
cgcatctcagcagctgctgcccttcgccaccctttcctggccaagtaccatgatcctgat
gatgagcctgactgtgccccgccctttgactttgcctttgaccgcgaagccctcactcgg
gagcgcattaaggaggccattgtggctgaaattgaggacttccatgcaaggcgtgagggc
atccgccaacagatccgcttccagccttctctacagcctgtggctagtgagcctggctgt
ccagatgttgaaatgcccagtccctgggctcccagtggggactgtgccatggagtctcca
ccaccagccccgccaccgtgccccggccctgcacctgacaccattgatctgaccctgcag
ccacctccaccagtcagtgagcctgccccaccaaagaaagagggtgccatctcagacaat
actaaggctgcccttaaagctgccctgctcaagtctttgaggagccggctcagagatggc
cccagtgcacccctggaggctcctgagcctcggaagccggtgacagcccaggagcgccag
cgggagcgggaggagaagcggcggaggcggcaagaacgagccaaggagcgggagaaacgg
cggcaggagcgggagcgaaaggaacggggggctggggcctctgggggcccctccactgac
cccttggctggactagtgctcagtgacaatgacagaagcctgttggaacgctggactcga
atggcccggcccgcagccccagcccccacctctgtgccggcccctgccccagcgccaacg
ccaaccccaaccccagtccaacctaccagtcctcttcctggccctgtagcccagcccact
ggcccgcaaccacaacctgcgggctctacctctggccctgtaccccagcctgcctgccca
ccccttggccctgcaccccaccccactggccctcctgggcccatccctgtccccgtgcca
ccccagattgccacctccaccagcctcctggctgcccagtcacttgtgccaccccctggg
ctgcctggctccagcaccccagggattttgccttacttcccacctggcctgccaccccca
gacgccgggggagcccctcagtcttccatgtcagagtcacctgatgtcaaccttgtgacc
caacagctatctaagtcacaggtggaggaccccctgccccctgtgttctcaggcacacca
aagggcagtggggctggctacggtgttggctttgacctggaggaattcttaaaccagtct
ttcgacatgggcgtggctgatgggccacaggatggccaggcagattcagcctctctctca
gcctccctgcttgctgactggctcgaaggccatggcatgaaccctgccgatattgagtcc
ctgcagcgtgagatccagatggactccccaatgctgctggctgacctgcctgacctccag
gacccctga

DBGET integrated database retrieval system