KEGG   Pan troglodytes (chimpanzee): 454699Help
Entry
454699            CDS       T01005                                 

Gene name
WNK4
Definition
(RefSeq) serine/threonine-protein kinase WNK4 isoform X5
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    454699 (WNK4)
   01009 Protein phosphatases and associated proteins [BR:ptr01009]
    454699 (WNK4)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     454699 (WNK4)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: Other
  Wnk family
   454699 (WNK4)
Protein phosphatases and associated proteins [BR:ptr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     454699 (WNK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 454699
NCBI-ProteinID: XP_003315535
Ensembl: ENSPTRG00000009221
VGNC: 9785
UniProt: H2QD38
Position
17
AA seq 1243 aa AA seqDB search
MLASPATETTVLMSQTEADLALRPPPPLGTAGQPRLGPPPRRARRFSGKAEPRPRSSRLS
RRSSVDLGLLSSWSLPASPAPDPPDPPDSAGPGPARSPPPSSKEPPEGTWTEGAPVKAAE
DSARPELPDSAVGPGSREPLRVPEAVALERRREQEEKEDMETQAVATSPDGRYLKFDIEI
GRGSFKTVYRGLDTDTTVEVAWCELQTRKLSRAERQRFSEEVEMLKGLQHPNIVRFYDSW
KSVLRGQVCIVLVTELMTSGTLKTYLRRFREMKPRVLQRWSRQILRGLHFLHSRVPPILH
RDLKCDNVFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDEAVDVYA
FGMCMLEMATSEYPYSECQNAAQIYRKVTSGRKPNSFHKVKIPEVKEIIEGCIRTDKNER
FTIQDLLAHAFFREERGVHVELAEEDDGEKPGLKLWLRMEDARRGGRPRDNQAIEFLFQL
GRDAAEEVAQEMVALGLVCEADYQPVARAVRERVAAIQRKREKLRKARELEALPPEPGPP
PATVPMAPGPPSVFPPEPEEPEADQHQPFLFRHASYSSTTSDCETDGYLSSSGFLDASDA
ALQPPGGVPSSLAESHLCLPSAFALSIPRSGPGSDFSPGDSYASDAASGLSDVGEGMGQM
RRPPARNLRRRPRSRLRVTSVSDQNDRVVECQLQTHNSKMVTFRFDLDGDSPEEIAAAMV
YNEFILPSERDGFLRRIREIIQRVETLLKRDTGPVEAAEDTLSPQEEPASLPALPVPLPD
PSNEELQSSTSLEHRSWTAFSTSSSSPGTPLSPGNPFSPGTPISPGPIFPITSPPCHPSP
SPFSPISSQVSSNPSPHPTSSPLPFSSSAPEFPVPLSQCPWSSLPTTSPPTFSPTCSQVT
LSSPFFPPCPSTSSFPSTTAAPLLSLASAFSLAVMTVAQSLLSPSPGLLSQSPPAPPSPL
PSLPLPPPLAPGGQESPSPHTAEVESEASPPPAWPLPGEARLAPISEEGKPQLVGRFQVT
SSKEPAEPLPLQPTSPTLSGSPKPSTPQLTSESSDTEDSAGGGPETREALAESDRAAEGL
GAGVEEEGDDGKEPQVGGSPQPLSHPSSVWMNYSYSSLCLSSEESESSGEDEEFWAELQS
LRQKHLSEVETLQTLQKKEIEDLYSRLGKQPPPGIVAPAAMLSSRQRRLSKGSFPTSRRN
SLQRSEPPGPGIMRRNSLSGSSTGSQEQRASKGVTFAGDVGRM
NT seq 3732 nt NT seq  +upstreamnt  +downstreamnt
atgttggcatccccggccacggagaccaccgtcctcatgtcccagactgaggccgacctg
gccctgcggcccccgccgcctcttggcaccgcggggcagccccgcctcgggccccctcct
cgccgagcgcgccgcttctccgggaaggctgagccccggccgcgctcttctcgtctcagc
cgccgtagctcagtcgacttggggctgctgagctcttggtccctgccagcctcacccgct
ccggacccccccgatcctccggactccgctggtcctggccccgcgaggagcccaccgcct
agctccaaagaaccccccgagggcacgtggaccgagggagcccctgtgaaggctgcagaa
gactccgcgcgtcccgagctcccggactctgcagtgggcccggggtccagggagccgctg
agggtccctgaagctgtggccctagagcggcggcgggagcaggaagaaaaggaggacatg
gagacccaggctgtagcaacgtcccccgatggccgatacctcaagtttgacatcgagatt
ggacgtggctccttcaagacggtgtatcgagggctagacaccgacaccacagtggaggtg
gcctggtgtgagctgcagactcggaaactgtctagagctgagcggcagcgcttctcagag
gaggtggagatgctcaaggggctgcagcaccccaacatcgtccgcttctacgattcgtgg
aagtcggtgctgaggggccaggtttgcatcgtgctggtcaccgaactcatgacctcgggc
acgctcaagacgtacctgaggcggttccgggagatgaagccgcgggtccttcagcgctgg
agccgccaaatcctgcggggacttcatttcctacactcccgggttcctcccatcctgcac
cgggatctcaagtgcgacaatgtctttatcacgggccctactggctctgtcaaaatcggg
gacctgggcctggccacgctcaagcgcgcctcctttgccaagagtgtcatcgggaccccg
gaattcatggcccccgagatgtacgaggaaaagtacgatgaggccgtggacgtgtacgcg
ttcggcatgtgcatgctggagatggccacctctgagtacccgtactccgagtgccagaat
gccgcgcaaatctaccgcaaggtcacttcgggcagaaagccgaacagcttccacaaggtg
aagatacccgaggtgaaggagatcattgaaggctgcatccgcacggataagaacgagagg
ttcaccatccaggacctcctggcccacgccttcttccgcgaggagcgcggtgtgcacgtg
gaactagcggaggaggacgacggcgagaagccgggcctcaagctctggctgcgcatggag
gacgcgcggcgcggggggcgcccacgggacaaccaggccatcgagttcctgttccagctg
ggccgggacgcggccgaggaggtggcacaggagatggtggctctgggcttggtctgtgaa
gccgattaccagccagtggcccgtgcagtacgtgaacgggttgctgccatccagcgaaag
cgtgagaagctgcgtaaagcaagggaattggaggcactcccaccagagccaggacctcca
ccagcaactgtgcccatggctcccggtccccccagtgtcttcccccctgagcctgaggag
ccagaggcagaccagcaccagcccttccttttccgccacgccagctactcatctaccact
tcggattgcgagactgatggctacctcagctcctccggcttcctggatgcctcagacgct
gcccttcagccccctgggggggtgccatccagcctggctgagtcccatctctgcctgccc
tcggcttttgccctatccattccacgttctggccctggaagtgacttttcccccggggac
agctatgcctcagatgcagcttcaggccttagcgatgtgggagaagggatgggacaaatg
aggagacccccagcgaggaatctccggcgcagaccccgatcccggctgcgggtcactagt
gtctcagaccagaatgacagagtggttgagtgccagctacagacccataacagcaagatg
gtgaccttccgatttgatctggatggggacagcccggaagagattgcagctgccatggta
tataacgagttcattctgccctcggagcgagatggatttctcagacggattcgggagatt
atccagcgagtggagaccctgttgaagagagacactggccccgtggaggctgctgaagac
accctaagcccccaggaggagccagcatcattacctgccctgcccgtccccctcccagac
ccatccaatgaagagctccagagcagcacctccctggagcacaggagctggacagccttc
tccacctcttcatcttctcctggaactcctttgtctcctggaaacccattttcccctgga
acccccatttcaccaggtcccatcttccccatcacttctcccccatgtcatcccagcccc
tccccattctcccccatttcttcccaggtctcctcaaatccctctccacaccccaccagc
tctccacttccattctcctccagcgcacccgagtttccggtcccactctctcagtgtccc
tggagttctctccccacgacttctccacctacgttctctcccacttgttctcaggtcact
cttagttcccctttctttcctccatgcccctccacttcttccttcccctccaccacagca
gcccctctcctttctctggctagtgccttctcactggctgtgatgactgtggcccagtcc
ctgctgtccccctcacctgggctcctttcccagtctcctccagcccctcctagtcccctc
cctagcctgccccttccccctccccttgctcctggtggccaggaaagcccttcaccccac
acagctgaggtggagagtgaggcctcaccacctcctgcttggcccctcccaggggaagcc
aggctggcgcccatctctgaagagggaaagccgcagcttgttgggcgtttccaagtgact
tcatccaaggaaccggctgagcctcttcccttgcagccaacatcccccactctctctggt
tctccaaaaccttcaacccctcagctcacttcagagagctcagatacagaggacagtgct
ggaggcgggccagagaccagggaagctctggctgagagcgaccgtgcagctgagggtctg
ggggctggagttgaggaggaaggagatgatgggaaggaaccccaagttgggggcagcccc
caacccctgagccatcccagctcagtgtggatgaactactcctacagcagcctgtgtttg
agcagcgaggagtcagaaagcagtggggaagatgaggagttctgggctgagctgcagagt
cttcggcagaagcacttgtcagaggtggaaacactacagacactacagaaaaaagaaatt
gaagatttgtacagccggctggggaagcagcccccaccgggtattgtggccccagctgct
atgctgtccagccgccagcgccgcctctccaagggcagcttccccacctcccgccgcaac
agcctacagcgctctgagcccccaggccctggcatcatgcgaaggaactctctgagtggc
agcagcaccggctcccaggagcagcgggcaagcaagggggtgacattcgccggggatgtt
ggcaggatgtga

DBGET integrated database retrieval system