KEGG   Pan troglodytes (chimpanzee): 454721Help
Entry
454721            CDS       T01005                                 

Gene name
HDAC5
Definition
(RefSeq) histone deacetylase 5 isoform X1
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04371  Apelin signaling pathway
ptr05034  Alcoholism
ptr05165  Human papillomavirus infection
ptr05169  Epstein-Barr virus infection
ptr05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    454721 (HDAC5)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    454721 (HDAC5)
  Substance dependence
   05034 Alcoholism
    454721 (HDAC5)
  Infectious diseases
   05169 Epstein-Barr virus infection
    454721 (HDAC5)
   05165 Human papillomavirus infection
    454721 (HDAC5)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     454721 (HDAC5)
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     454721 (HDAC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 454721
NCBI-ProteinID: XP_024205991
Ensembl: ENSPTRG00000009263
VGNC: 9316
Position
17
AA seq 1123 aa AA seqDB search
MNSPNESADGMSGREPSLEILPRTSLHSIPVTVEVKPVLPRAMPSSMGGGGGGSPSPVEL
RGALVGSVDPTLREQQLQQELLALKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKQ
QQEMLAAKQQQEMLAAKRQQELEQQRQREQQRQEELEKQRLEQQLLILRNKEKSKESAIA
STEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPPQSGPPGTPPSYK
LPLPGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTVISTFKKRAVE
ITGAGPGASSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLPQHRALPLDSSPN
QFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMS
TSSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVAT
SMRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQQLQLGKILTKTG
ELPRQPTTHPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEEDGEEEE
DCIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQPLQPLQVYQAPLSLATVPHQALGRT
QSSPAAPGGMKSPPDQPVKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHAGRIQSIWSRLQ
ETGLLSKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGPISQKMYAVL
PCGGIGVDSDTVWNEMHSSSAVRMAVGCLLELAFKVAAGELKNGFAIIRPPGHHAEESTA
MGFCFFNSVAITAKLLQQKLNVGKVLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGN
FFPGSGAPEEVGGGPGVGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAHEFSPDVVLV
SAGFDAVEGHLSPLGGYSVTARCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACV
SALLSVELQPLDEAVLQQKPNINAVATLEKVIEIQSKHWSCVQKFAAGLGRSLREAQAGE
TEEAETVSAMALLSVGAEQAQAAAAREHSPRPAEEPMEQEPAL
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
atgaactctcccaacgagtcggcagatgggatgtcaggccgggaaccatccttggaaatc
ctgccgcggacttctctgcacagcatccctgtgacagtggaggtgaagccggtgctgcca
agagccatgcccagttccatggggggtgggggtggaggcagccccagccctgtggagcta
cggggggctctggtgggctctgtggaccccacactgcgggagcagcaactgcagcaggag
ctcctggcgctcaagcagcagcagcagctgcagaagcagctcctgttcgctgagttccag
aaacagcatgaccacctgacaaggcagcatgaagtccagctgcagaagcacctcaagcag
cagcaggagatgctggcagccaagcagcagcaggagatgctggcagccaagcggcagcag
gagctggagcagcagcggcagcgggagcagcagcggcaggaagagctggagaagcagcgg
ctggagcagcagctgctcatcctgcggaacaaggagaagagcaaagagagtgccattgcc
agcaccgaggtaaagctgaggctccaggaattcctcttgtcgaagtcaaaggagcccaca
ccaggcggcctcaaccattccctcccacagcaccccaaatgctggggagcccaccatgct
tctttggaccagagttcccctccccagagcggcccccctgggacgcctccctcctacaaa
ctgcctttgcctgggccctacgacagtcgagacgacttccccctccgcaaaacagcctct
gaacccaacttgaaagtgcgttcaaggctaaaacagaaggtggccgagcggagaagcagt
cccctcctgcgtcgcaaggatgggactgttattagcacctttaagaagagagctgttgag
atcacaggtgccgggcctggggcgtcgtccgtgtgtaacagcgcacccggctccggcccc
agctctcccaacagctcccacagcaccatcgctgagaatggctttactggctcagtcccc
aacatccccactgagatgctccctcagcaccgagccctccctctggacagctcccccaac
cagttcagcctctacacgtctccttctctgcccaacatctccctagggctgcaggccacg
gtcactgtcaccaactcacacctcactgcctccccgaagctgtcgacacagcaggaggcc
gagaggcaggccctccagtccctgcggcagggtggcacgctgacaggcaagttcatgagc
acatcctctattcctggctgcctgctgggcgtggcactggagggcgacgggagcccccac
gggcatgcctccctgctgcagcatgtgctgttgctggagcaggcccggcagcagagtacc
ctcattgctgtgccactccacgggcagtccccactagtgacgggtgaacgtgtggccacc
agcatgcggacggtaggcaagctcccgcggcatcggcccctgagccgcactcagtcctca
ccgctgccgcagagtccccaggccctgcagcagctggtcatgcaacaacagcaccagcag
ttcctggagaagcagaagcagcagcagctacagctgggcaagatcctcaccaagacaggg
gagctgcccaggcagcccaccacccaccctgaggagacagaggaggagctgacagagcag
caggaggtcttgctgggggagggagccctgaccatgccccgggagggctccacagagagt
gagagcacacaggaagacctggaggaggaggacgaggaagaggatggggaggaggaggag
gattgcatccaggttaaggacgaggagggcgagagtggtgctgaggaggggcccgacttg
gaggagcctggtgctggatacaaaaaactgttctcagatgcccagccgctgcagcctttg
caggtgtaccaggcgcccctcagcctggccactgtgccccaccaggccctgggccgtacc
cagtcctcccctgctgcccctgggggcatgaagagccccccagaccagcccgtcaagcac
ctcttcaccacaggtgtggtctacgacacgttcatgctaaagcaccagtgcatgtgcggg
aacacacacgtgcaccctgagcatgctggccggatccagagcatctggtcccggctgcag
gagacaggcctgcttagcaagtgcgagcggatccgaggtcgcaaagccacgctagatgag
atccagacagtgcactctgaataccacaccctgctctatgggaccagtcccctcaaccgg
cagaagctagacagcaagaagttgctcggccccatcagccagaagatgtatgctgtgctg
ccttgtgggggcatcggggtggacagtgacaccgtgtggaatgagatgcactcctccagt
gctgtgcgcatggcagtgggctgcctgctggagctggccttcaaggtggctgcaggagag
ctcaagaatggatttgccatcatccggcccccaggacaccacgccgaggaatccacagcc
atgggattctgcttcttcaactctgtagccatcaccgcaaaactcctacagcagaagttg
aacgtgggcaaggtcctcatcgtggactgggacattcaccatggcaatggcacccagcag
gcgttctacaatgacccctctgtgctctacatctctctgcatcgctatgacaacgggaac
ttctttccaggctctggggctcctgaagaggttggtggaggaccaggcgtggggtacaat
gtgaacgtggcatggacaggaggtgtggacccccccattggagacgtggagtaccttaca
gccttcaggacagtggtgatgcccattgcccacgagttctcacctgatgtggtcctagtc
tccgccgggtttgatgctgttgaaggacatctgtctcctctgggtggctactctgtcacc
gccagatgttttggccacttgaccaggcagctgatgaccctggcagggggccgggtggtg
ctggccctggagggaggccatgacttgaccgccatctgtgatgcctctgaggcttgtgtc
tcggctctgctcagtgtagagctgcagcccttggatgaggcagtcttgcagcaaaagccc
aacatcaacgcagtggccacgctagagaaagtcatcgagatccagagcaaacactggagc
tgtgtgcagaagttcgccgctggtctgggccggtccctgcgagaggcccaagcaggtgag
accgaggaggccgagactgtgagcgccatggccttgctgtcggtgggggccgagcaggcc
caggctgcggcagcccgggaacacagccccaggccggcagaggagcccatggagcaggag
cctgccctgtga

DBGET integrated database retrieval system