KEGG   Pan troglodytes (chimpanzee): 454806Help
Entry
454806            CDS       T01005                                 

Gene name
USP32
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 32 isoform X1
  KO
K11837  ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.4.19.12]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     454806 (USP32)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   454806 (USP32)
Ubiquitin system [BR:ptr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    454806 (USP32)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH DUSP UCH_1 EF-hand_6 EF-hand_1 EF-hand_5 EF-hand_7 Ubiquitin_3 Ubiquitin_2 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 454806
NCBI-ProteinID: XP_024206472
Ensembl: ENSPTRG00000009483
VGNC: 9771
Position
17
AA seq 1634 aa AA seqDB search
MCGVERRLWQSAQQVRRGWRPFSQEYCQMLILTPPVTDVELKRLKDAFKRTCGLSYYMGQ
HCFIREVLGDGVPPKVAEVIYCSFGGTSKGLHFNNLIVGLVLLTRGKDEEKAKYIFSLFS
SESGNYVIREEMERMLHVVDGKVPDTLRKCFSEGEKVNYEKFRNWLFLNKDAFTFSRWLL
SGGVYVTLTDDSDTPTFYQTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFGPLV
SPPIRPSLSEGLFNAFDENRDNHIDFKEISCGLSACCRGPLAERQKFCFKVFDVDRDGVL
SRVELRDMVVALLEVWKDNRTDDIPELHMDLSDIVEGILNAHDTTKMGHLTLEDYQIWSV
KNVLANEFLNLLFQVCHIVLGLRPATPEEEGQIIRGWLERESRYGLQAGHNWFIISMQWW
QQWKEYVKYDANPVVIEPSSVLNGGKYSFGTAAHPMEQVEDRIGSSLSYVNTTEEKFSDN
ISTASEASETAGSGFLYSATPGADVCFARQHNTSDNNNQCLLGANGNILLHLNPQKPGAI
DNQPLVTQEPVKATSLTLEGGRLKRAPQLIHGRDYEMVPEPVWRALYHWYGANLALPRPV
IKNSKTDIPELELFPRYLLFLRQQPATRTQQSNIWVNMGMMSLRMFPQHLPRGNVPSPNA
PLKRVLAYTGCFSRMQTIKEIHEYLSQRLRIKEEDMRLWLYNSENYLTLLDDEDHKLEYL
KIQDEQHLVIEVRNKDMSWPEEMSFIANSSKIDRHKVPTEKGATGLSNLGNTCFMNSSIQ
CVSNTQPLTQYFISGRHLYELNRTNPIGMKGHMAKCYGDLVQELWSGTQKNVAPLKLRWT
IAKYAPRFNGFQQQDSQELLAFLLDGLHEDLNRVHEKPYVELKDSDGRPDWEVAAEAWDN
HLRRNRSIVVDLFHGQLRSQVKCKTCGHISVRFDPFNFLSLPLPMDSYMHLEITVIKLDG
TTPVRYGLRLNMDEKYTGLKKQLSDLCGLNSEQILLAEVHGSNIKNFPQDNQKVRLSVSG
FLCAFEIPVPVSPISASSPTQTDFSSSPSTNGMFTLTTNGDLPRPIFIPNGMPNTVVPCG
TEKNFTNGMVNGHMPSLPDSPFTGYIIAVHRKMMRTELYFLSSQKNRPSLFGMPLIVPCT
VHTRKKDLYDAVWIQVSRLASPLPPQEASNHAQDCDDSMGYQYPFTLRVVQKDGNSCAWC
PWYRFCRGCKIDCGEDRAFIGNAYIAVDWDPTALHLRYQTSQERVVDEHESVEQSRRAQA
EPINLDSCLRAFTSEEELGENEMYYCSKCKTHCLATKKLDLWRLPPILIIHLKRFQFVNG
RWIKSQKIVKFPRESFDPSAFLVPRDPALCQRKPLTPQGDELSEPRILAREVKKVDAQSS
AGEEDVLLSKSPSSLSANIISSPKGSPSSSRKSGTSCPSSKNSSPNSSPRTLGRSKGRLR
LPQIGSKNKLSSSKENLDASKENGAGQICELADALSRGHVLGGSQPELVTPQDHEVALAN
GFLYEHEACGNGYSNGQLGNHSEEDSTDDQREDTRIKPIYNLYAISCHSGILGGGHYVTY
AKNPNCKWYCYNDSSCKELHPDEIDTDSAYILFYEQQGIDYAQFLPKTDGKKMADTSSMD
EDFESDYKKYCVLQ
NT seq 4905 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggggtcgagcgaagactttggcagagcgcacagcaggtcaggagaggctggcgc
cccttctcccaagaatactgtcagatgctgatcctgacaccacctgttacagatgtagag
ctaaaacgactgaaggatgctttcaagaggacctgtggactctcatattacatgggccag
cactgcttcatccgggaagtgcttggggatggagtgcctccaaaagttgctgaggtgatt
tactgttcttttggtggaacatccaaagggctgcacttcaataatttaatagttggactt
gtcctccttacaagaggcaaagatgaagagaaagcaaaatacatttttagtcttttttca
agtgaatctgggaactatgttatacgggaagaaatggaaagaatgctccatgtggtggat
ggtaaagtcccagatacactcaggaagtgtttctcagagggtgaaaaggtaaactatgaa
aagtttagaaattggctttttctaaacaaagatgcttttactttctctcgatggcttcta
tctggaggtgtgtatgttaccctcactgatgatagtgatactcctactttctaccaaact
ctggctggagtcacacatttggaggaatcagacatcattgatcttgagaaacgctattgg
ttattgaaggctcaatcccggactggacgatttgatttagagacatttggcccattggtt
tcaccacctattcgtccatctctaagtgaaggtttgtttaatgcttttgatgaaaatcgt
gacaatcacatagattttaaggagatatcctgtgggttatcagcctgttgcaggggaccc
ctggctgaaagacaaaaattttgcttcaaggtatttgatgttgaccgtgatggagttctc
tccagggttgaactgagagacatggtggttgcacttttagaagtctggaaggacaaccgc
actgatgatattcctgaattacatatggatctctctgatattgtagaaggcatattgaat
gcacatgacaccacaaagatgggtcatcttactctggaagactatcagatctggagtgtg
aaaaatgttcttgccaatgagtttttgaacctccttttccaggtgtgtcacatagttctg
gggttaagaccagctactccggaagaagaaggacaaattattagaggatggttagaacga
gagagcaggtatggtctgcaagcaggacacaactggtttatcatctccatgcagtggtgg
caacagtggaaagaatatgtcaaatacgatgccaaccctgtggtaattgagccatcatct
gttttgaatggaggaaaatactcatttggaactgcagcccatcctatggagcaggtcgaa
gatagaattggaagcagcctcagttatgtgaatactacagaagagaaattttcagacaac
atttctactgcatctgaagcctcagaaactgctggcagcggctttctgtattctgccaca
ccaggggcagatgtttgctttgctcgacaacataacacttctgacaataacaaccagtgt
ttgctgggagccaatgggaatattttgttgcaccttaaccctcagaaaccaggggctatt
gataatcagccattagtaactcaagaaccagtaaaggctacatcattaacactagaagga
ggacgattaaaacgagctccacagctgattcatggaagagactatgaaatggtcccagaa
cctgtgtggagagcactttatcactggtatggagcaaacctggccttacctagaccagtt
atcaagaacagcaagacagacatcccagagctggaattatttccccgctatcttctcttc
ctgagacagcagcctgccactcggacacagcagtctaacatctgggtgaatatgggtatg
atgagcctgagaatgtttcctcagcatttaccgagaggaaatgtaccttctccgaatgca
cctttaaagcgggtattagcctatacaggctgttttagtcgaatgcagaccatcaaggaa
attcacgaatatctatctcaaaggctgcgcattaaagaggaagatatgcgcctgtggcta
tacaacagtgagaactaccttactcttctggatgatgaggatcataaattggaatatttg
aaaatccaggatgaacaacacctggtaattgaagttcgcaacaaagatatgagttggcct
gaggagatgtcttttatagcaaatagtagtaaaatagatagacacaaggttcccacagaa
aagggagccacaggtctaagcaacctgggaaacacatgcttcatgaactcaagcatccag
tgtgttagtaacacacagccactgacacagtattttatctcagggagacatctttatgaa
ctcaacaggacaaatcccattggtatgaaggggcatatggctaaatgctatggtgattta
gtgcaggaactttggagtggaactcagaagaatgttgccccattaaagcttcggtggacc
atagcaaaatatgctcccaggtttaatgggtttcagcaacaggactcccaagaacttctg
gcttttctcttggatggtcttcatgaagatcttaatcgagtccatgaaaagccatatgtg
gaactgaaggacagtgatgggcgaccagactgggaagtagctgcagaggcctgggacaac
catctaagaagaaatagatcaattgttgtggatttgttccatgggcagctaagatctcaa
gtaaaatgcaagacatgtgggcatataagtgtccgatttgaccctttcaattttttgtct
ttgccactaccaatggacagttatatgcacttagaaataacagtgattaagttagatggt
actacccctgtacggtatggactaagactgaatatggatgaaaagtacacaggtttaaaa
aaacagctgagtgatctctgtggacttaattcagaacaaatccttctagcagaagtacat
ggttccaacataaagaactttcctcaggacaaccaaaaagtacgactctcagtgagtgga
tttttgtgtgcatttgaaattcctgtccctgtgtctccaatttcagcttctagtccaaca
cagacagatttctcctcttcgccatctacaaatggaatgttcaccctaactaccaatggg
gacctaccccgaccaatattcatccccaatggaatgccaaacactgttgtgccatgtgga
actgagaagaacttcacaaatggaatggttaatggtcacatgccatctcttcctgacagc
ccctttacaggttacatcattgcagtccaccgaaaaatgatgaggacagaactgtatttc
ctgtcatctcagaagaatcgccccagcctctttggaatgccattgattgttccatgtact
gtgcatacccggaagaaagacctatatgatgcggtttggattcaagtatcccggttagcg
agcccactcccacctcaggaagctagtaatcatgcccaggattgtgatgacagtatgggc
tatcaatatccattcactctacgagttgtgcagaaagatgggaactcctgtgcttggtgc
ccatggtatagattttgcagaggctgtaaaattgattgtggggaagacagagctttcatt
ggaaatgcctatatcgctgtggattgggaccccacagcccttcaccttcgctatcaaaca
tcccaggaaagggttgtagatgagcatgagagtgtggagcagagtcggcgagcgcaagcc
gagcccatcaacctggacagctgtctccgtgctttcaccagtgaggaagagctaggggaa
aatgagatgtactactgttccaagtgtaagacccactgcttagcaacaaagaagctggat
ctctggaggcttccacccatcctgattattcaccttaagcgatttcaatttgtaaatggt
cggtggataaaatcacagaaaattgtcaaatttcctcgggaaagttttgatccaagtgct
tttttggtaccaagagacccggctctctgccagcgtaaaccactcacaccccagggggat
gagctctctgagcccaggattctggcaagggaggtgaagaaagtggatgcgcagagttcg
gctggggaagaggacgtgctcctgagcaaaagcccatcctcactcagcgctaacatcatc
agcagcccgaaaggttctccttcttcatcaagaaaaagtggaaccagctgtccctccagc
aaaaacagcagccctaatagcagcccacggactttggggaggagcaaagggaggctccgg
ctgccccagattggcagcaaaaataaactgtcaagtagtaaagagaacttggatgccagc
aaagaaaatggggctgggcagatatgtgagctggctgacgccttgagtcgagggcatgtg
ctggggggcagccaaccagagttggtcactcctcaggaccacgaggtagctttggccaat
ggattcctttatgagcatgaagcatgtggcaatggctacagcaatggtcagcttggaaac
cacagtgaagaagacagcactgatgaccaaagagaagatactcgtattaagcctatttat
aatctatatgcaatttcgtgccattcaggaattctgggtgggggccattacgtcacttat
gccaaaaacccaaactgcaagtggtactgttacaatgacagcagctgtaaggaacttcac
ccggatgaaattgacaccgactctgcctacattcttttctatgagcagcaggggatagac
tatgcacaatttctgccaaagactgatggcaaaaagatggcagacacaagcagtatggat
gaagactttgagtctgattacaaaaagtactgtgtgttacagtaa

DBGET integrated database retrieval system