KEGG   Pan troglodytes (chimpanzee): 454829
Entry
454829            CDS       T01005                                 
Symbol
RGS9
Name
(RefSeq) regulator of G-protein signaling 9 isoform X2
  KO
K13765  regulator of G-protein signaling 9
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04744  Phototransduction
ptr05030  Cocaine addiction
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    454829 (RGS9)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    454829 (RGS9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ptr03037]
    454829 (RGS9)
Cilium and associated proteins [BR:ptr03037]
 Primary cilia and associated proteins
  Other primary cilia associated proteins
   454829 (RGS9)
SSDB
Motif
Pfam: RGS_DHEX RGS DEP G-gamma
Other DBs
NCBI-GeneID: 454829
NCBI-ProteinID: XP_009431352
Ensembl: ENSPTRG00000009552
VGNC: 9561
UniProt: A0A2J8QY39
Position
17:58197254..58290894
AA seq 671 aa
MTIRHQGQQYRPRMAFLQKIEALVKDMQNPETGVRMQNQRVLVTSVPHAMTGSDVLQWIV
QRLWISSLEAQNLGNFIVRYGYIYPLQDPKNLILKPDGSLYRFQTPYFWPTQQWPAEDID
YAIYLAKRNIKKKGILEEYEKENYNFLNQKMNYKWDFVIMQAKEQYRAGKERNKADRYAL
DCQEKAYWLVHRCPPGMDNVLDYGLDRVTNPNEVKKQTVVAVKKEIMYYQQALMRSTVKS
SVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQFWDLNAKLVEIPTKMRVERWAFNF
SELIRDPKGRQSFQYFLKKEFSGENLGFWEACEDLKYGDQSKVKEKAEEIYKLFLAPGAR
RWINIDGKTMDITVKGLKHPHRYVLDAAQTHIYMLMKKDSYARYLKSPIYKDMLAKAIEP
QETTKKSSTLPFMRRHLRSSPSPVILRQLEEEAKAREAANTVDITQPGQHMAPSPHLTVY
TGTCVPPSPSSPFSSSCRSPRKPFASPSRFIRRPSTTICPSPIRVALESSSGLEQKGECS
GSMAPRGPSVTESSEASLDTSWPRSRPRAPPKARMALSFSRFLRRGCLASPVFARLSPKC
PAVSHGRVQPLGDVGQQLPRLKSKRVANFFQIKMDVPTGSGTCLMDSEDAGTGESGDRAT
EKEVICPWESL
NT seq 2016 nt   +upstreamnt  +downstreamnt
atgacaatccgacaccaaggccagcagtacaggccgaggatggcatttctccaaaagatt
gaagcgctcgtgaaggacatgcagaacccagagacaggggtccgaatgcagaaccagagg
gtcctggtcaccagcgttcctcatgccatgacaggaagtgatgttctgcaatggatcgtc
cagcggctttggatctccagtctggaggcacagaacttgggcaactttattgtcaggtat
ggctacatttacccgctgcaagaccccaagaatctcattctcaagcctgatggcagcctc
tacagatttcagacaccgtatttctggcccacccagcagtggccagctgaagatatcgat
tacgccatctatctggccaagcgaaatatcaaaaagaaagggattttggaagaatatgaa
aaggaaaattacaatttcttgaaccaaaaaatgaactataagtgggactttgtcattatg
caggccaaagagcagtacagggctggaaaggagaggaacaaagcagacagatatgccctg
gactgccaggagaaggcatactggctggtgcaccgatgccctcctggaatggacaatgtg
ctggactacggcctggaccgagtgaccaatccgaatgaagtcaagaaacaaacagtcgtt
gctgtcaaaaaagagatcatgtattaccaacaggccttgatgaggtccacagtgaagtct
tctgtgtccctgggagggattgtgaaatacagtgagcagttctcatccaacgatgccatc
atgtcaggctgcctccccagcaacccctggatcaccgatgacacccagttctgggactta
aacgccaaattggtggaaatcccaaccaagatgcgagtggaacgatgggccttcaacttc
agcgaattgatccgagaccccaaaggtcgacagagcttccagtacttcctcaagaaagaa
ttcagtggagagaatctgggattctgggaagcctgtgaggatctgaagtatggagatcag
tccaaagtcaaggagaaagcagaggagatttacaagctgttcctggccccgggggcgagg
cgctggatcaacatagatggcaaaaccatggacatcacagtgaaggggctgaagcacccc
caccgctatgtgctggacgccgcacaaacccacatttacatgctcatgaagaaggattct
tatgctcgctatttaaaatctccgatctataaggacatgctggccaaagctattgaacct
caggaaaccaccaagaaaagctccaccctcccttttatgcggcgtcacctgcgctccagc
ccaagccctgtcatcctgaggcagctggaagaggaagccaaggcccgagaagcagccaac
actgtggacatcacccagccgggccagcacatggctcccagcccccatctgaccgtgtac
accgggacctgcgtgcccccgtctccttctagccccttctcctcctcctgccgctccccc
aggaagcctttcgcctcacccagccgcttcatccggcgacccagcaccaccatctgcccc
tcacccatcagagtggccttggagagctcgtcgggcttggagcagaaaggggagtgcagc
gggtccatggccccccgtgggccctctgtcaccgagagcagcgaggcctccctcgacacc
tcctggcctcgcagccggcccagggcccctcctaaggcccgcatggctctgtccttcagc
aggtttctgagacgaggctgtctggcctcacctgtctttgccaggctctcacccaagtgc
cctgctgtgtcccacgggagggtgcagcccctgggggatgtgggccagcagctgccacga
ctgaaatccaagagagtagcaaactttttccagatcaaaatggatgtgcccacggggagc
gggacctgcttgatggactcggaggacgctggaacaggagagtcgggtgaccgggccaca
gaaaaggaggttatctgtccctgggagagcctgtga

DBGET integrated database retrieval system