KEGG   Pan troglodytes (chimpanzee): 455156Help
Entry
455156            CDS       T01005                                 

Gene name
HSF5
Definition
(RefSeq) heat shock factor protein 5 isoform X1
Organism
ptr  Pan troglodytes (chimpanzee)
SSDB OrthologParalogGFIT
Motif
Pfam: HSF_DNA-bind
Motif
Other DBs
NCBI-GeneID: 455156
NCBI-ProteinID: XP_016788143
Ensembl: ENSPTRG00000009453
VGNC: 9328
Position
17
AA seq 605 aa AA seqDB search
MEALLSTPINPNNFPAKLWRLVNSPRYRSIRWDGRGEGLLIDQPLFEAELLSPPGPGGGG
GTAGAGAEPELFKTTSFTSFIRQLNLYGFRKVVLGGPGGGKPAGNGPLHHFHNPHFRRDQ
PQLLVHLKRLTSANKAKLAAGLEVPCRPPNRFQRLLITSASASAAAAPLQHQQPPPPAGP
RPEPQGPVAVGQFHRSFRRDSLSPYSCVSTPSHDHSTYPLKGLDRTPVPHRIWQNSLGMH
PGQVETSPTFSDKGVPFAVLQRFPTEVTYTLQPSTTSVHVQQGPQTMVSSSQKYSNYTPS
AQYSQAYYPTAVLQCCSPTHMDALSSCVTPTASSYAHCNYFQLYFFFSQNPSMQSSYPVE
FLPSNWPCSTTDENTKTEVNLEAVFQIVDELHSSPKLEMVKVEPVENQCPTSPSYRGQHI
LANSNNSNPCSASQASQLEPLTPVGSDIMSFVVGTEQAVASSLPQSPEYIYTIHTAQPVE
NSTIQESAAIQQAHVKLKEHLNHNPSPSSVVFVQEGPPFSTHQVDANIKCQTSSRENILP
SEQMGFLISEMGPASKPSEDTGLATPARYREHRSNSQQGKSPDLHLLVDVACKQERFPKE
EELKE
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgctgctctccacccccatcaaccccaacaacttccctgccaagctgtggcgc
ctggtgaacagcccgcgctaccgctccatccgctgggacggccgcggcgaggggctgctt
atcgaccagccgctcttcgaggccgagctgctcagcccgcccgggccggggggcggtggc
gggactgcgggggccggggccgagcccgagctcttcaaaaccaccagcttcaccagcttc
atccgccagctcaacctctacggcttccgcaaggtggtgctgggcgggccggggggcggc
aaaccggcaggcaatgggccgctccatcacttccacaacccgcacttccgccgcgaccag
ccacagctgctcgtgcacctcaagcgcctcaccagcgccaacaaggccaagctggcggcc
ggcctggaggtgccctgccgcccgcccaaccgcttccagcggctgctcatcacctcggcc
tccgcctccgccgccgccgcgccgctgcagcaccagcagccgccgccgcccgcggggccc
cggcccgagccgcaaggaccagtggctgtaggacaatttcaccggtcatttcgtcgagat
agtttgtctccttactcctgtgtatcaactccatcccacgaccacagtacttaccctctg
aaaggtttagatcggaccccagttcctcatagaatatggcagaactcccttggaatgcat
cctggacaagtggagacatctcccacattttcagataaaggggttccgtttgctgtactc
cagaggtttccaactgaggttacctatacactgcagcccagcaccacatctgtacatgtt
caacaaggtcctcaaacaatggtcagctcctcccaaaaatacagtaactacacaccctca
gcacagtactcgcaagcctactatccaacagctgtgctacagtgctgttctcctacccac
atggatgctctaagtagttgtgtcactcccactgcctcttcctatgcacactgcaactac
ttccagttatattttttcttttcccagaatccttcaatgcagtcctcctatccagttgaa
tttttgccttccaattggccctgcagtactactgatgaaaatacaaagacagaagtaaac
ctagaggctgtctttcagatagttgatgagttgcattcctcccctaaattggagatggta
aaggtggagcctgttgagaatcagtgcccaacatctccgtcttacagaggccaacacatt
ttagctaattctaacaacagcaatccatgttctgcaagtcaggctagccagctggagcca
cttactcctgtaggctcagatattatgtcttttgtggttggaacagaacaagcagttgcc
agctctctaccacagtcacctgagtacatctataccatccacacagctcagcctgttgaa
aatagcacaatacaggaatctgcagccatccagcaagctcatgtcaaactgaaggagcac
ctaaatcataatccatctccatcttcagtagtatttgtgcaggaagggccaccattcagc
acacaccaggtggatgccaatataaaatgccagaccagttcacgtgagaatatcttgccg
tcagaacagatgggattcctcatttcagaaatggggcctgctagcaagcctagtgaagac
acaggtttagccactccagccagatacagagagcacagaagcaactcacaacaaggaaag
tcccctgatcttcatctgctggtggacgtggcctgcaagcaggagcgctttccaaaggag
gaagaattaaaagagtga

DBGET integrated database retrieval system